Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DESI4OK)

DME Name Retinol dehydrogenase 5 (RDH5)
Synonyms
Dehydrogenase/reductase family 9C member 5; 11-cis RDH; 11-cis RoDH; 11-cis retinol dehydrogenase; 9-cis retinol dehydrogenase; Short chain dehydrogenase/reductase family 9C member 5; 9cRDH; HSD17B9; RDH1; RDH5; SDR9C5
Gene Name RDH5
UniProt ID
RDH5_HUMAN
INTEDE ID
DME0583
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5959
EC Number EC: 1.1.1.315
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.315
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MWLPLLLGALLWAVLWLLRDRQSLPASNAFVFITGCDSGFGRLLALQLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDITDPQSVQQAAKWVEMHVKEAGLFGLVNNAGVAGIIGP
TPWLTRDDFQRVLNVNTMGPIGVTLALLPLLQQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQAHYGGA
FLTKYLKMQQRIMNLICDPDLTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQAVY
Function
This enzyme catalyzes the oxidation of cis-isomers of retinol, including 11-cis-, 9-cis-, and 13-cis-retinol in an NAD-dependent manner. But it has no activity towards all-trans retinal. It plays a significant role in 11-cis retinol oxidation in the retinal pigment epithelium cells (RPE). and also recognizes steroids (androsterone, androstanediol) as its substrates.
KEGG Pathway
Retinol metabolism (hsa00830 )
Reactome Pathway
Retinoid cycle disease events (R-HSA-2453864 )
The canonical retinoid cycle in rods (twilight vision) (R-HSA-2453902 )
RA biosynthesis pathway (R-HSA-5365859 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Vitamin A DMJ2AH4 Night blindness 9D45 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.10E-11 -4.65E-01 -7.48E-01
Alopecia ED70 Skin from scalp 8.53E-02 -9.63E-02 -2.72E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.64E-08 4.19E-01 1.02E+00
Ankylosing spondylitis FA92.0 Pheripheral blood 3.59E-01 -4.35E-02 -1.71E-01
Aortic stenosis BB70 Calcified aortic valve 6.70E-01 1.68E-01 4.51E-01
Apnea 7A40 Hyperplastic tonsil 3.13E-01 1.41E-01 3.91E-01
Arthropathy FA00-FA5Z Peripheral blood 2.95E-01 -1.14E-01 -4.43E-01
Asthma CA23 Nasal and bronchial airway 1.86E-03 -2.66E-01 -4.58E-01
Atopic dermatitis EA80 Skin 1.46E-02 2.33E-01 9.63E-01
Autism 6A02 Whole blood 1.76E-01 2.43E-01 3.51E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.22E-03 7.69E-01 2.79E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.33E-02 1.20E+00 2.36E+00
Bacterial infection of gingival 1C1H Gingival tissue 9.95E-01 4.11E-03 1.76E-02
Batten disease 5C56.1 Whole blood 2.19E-01 -1.06E-01 -4.71E-01
Behcet's disease 4A62 Peripheral blood 1.73E-01 1.32E-01 3.40E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.76E-01 -7.95E-02 -3.27E-01
Bladder cancer 2C94 Bladder tissue 1.41E-03 3.74E-01 1.84E+00
Breast cancer 2C60-2C6Z Breast tissue 1.39E-63 -8.61E-01 -1.29E+00
Cardioembolic stroke 8B11.20 Whole blood 2.66E-01 1.28E-01 4.40E-01
Cervical cancer 2C77 Cervical tissue 1.26E-01 -1.35E-01 -5.10E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.92E-02 -2.90E-01 -6.48E-01
Chronic hepatitis C 1E51.1 Whole blood 8.15E-01 -1.97E-02 -7.64E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 1.91E-01 -2.27E-02 -4.56E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.50E-01 -7.45E-02 -1.61E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.16E-02 2.26E-01 2.32E+00
Colon cancer 2B90 Colon tissue 2.59E-10 -2.89E-01 -8.00E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.55E-01 -3.16E-01 -3.39E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.19E-01 3.79E-02 3.25E-02
Endometriosis GA10 Endometrium tissue 8.49E-01 -1.17E-01 -3.34E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.97E-01 1.73E-01 8.06E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.01E-01 1.61E-01 5.89E-01
Gastric cancer 2B72 Gastric tissue 3.08E-01 -8.07E-01 -7.84E-01
Glioblastopma 2A00.00 Nervous tissue 2.90E-03 2.67E-02 4.56E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.60E-01 2.25E-01 6.57E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.00E-04 6.11E-01 1.54E+00
Head and neck cancer 2D42 Head and neck tissue 4.87E-21 -5.22E-01 -1.13E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.43E-01 9.53E-02 3.51E-01
Huntington's disease 8A01.10 Whole blood 7.78E-01 7.65E-02 2.35E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.05E-01 1.50E-01 4.58E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.76E-02 -2.19E-01 -7.40E-01
Influenza 1E30 Whole blood 3.21E-01 2.28E-01 8.40E-01
Interstitial cystitis GC00.3 Bladder tissue 2.03E-02 1.66E-01 9.41E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.63E-02 -4.38E-01 -6.83E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.69E-02 -2.23E-01 -3.17E-01
Ischemic stroke 8B11 Peripheral blood 3.04E-01 -7.56E-02 -2.39E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.80E-04 -1.78E-01 -1.96E-01
Lateral sclerosis 8B60.4 Skin 3.53E-02 1.81E-01 1.61E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 7.03E-01 -3.11E-01 -5.84E-01
Liver cancer 2C12.0 Liver tissue 3.38E-03 -3.68E-01 -7.10E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.45E-01 2.71E-01 5.85E-01
Lung cancer 2C25 Lung tissue 6.69E-02 -2.69E-03 -7.36E-03
Lupus erythematosus 4A40 Whole blood 1.39E-01 -2.47E-02 -8.03E-02
Major depressive disorder 6A70-6A7Z Hippocampus 6.41E-01 3.43E-03 1.37E-02
Major depressive disorder 6A70-6A7Z Whole blood 3.23E-01 3.12E-02 1.03E-01
Melanoma 2C30 Skin 6.34E-01 -1.41E-01 -1.55E-01
Multiple myeloma 2A83.1 Peripheral blood 4.56E-02 2.01E-01 8.18E-01
Multiple myeloma 2A83.1 Bone marrow 2.00E-04 -5.85E-01 -2.68E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.95E-01 -2.31E-01 -3.06E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.01E-01 -1.70E-01 -3.64E-01
Myelofibrosis 2A20.2 Whole blood 1.06E-03 2.98E-01 1.34E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.21E-01 -2.31E-01 -3.01E-01
Myopathy 8C70.6 Muscle tissue 1.21E-01 -3.19E-01 -4.73E-01
Neonatal sepsis KA60 Whole blood 5.70E-07 4.57E-01 7.19E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.49E-03 -5.51E-01 -2.12E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.11E-02 -2.00E-01 -1.16E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.45E-01 2.87E-01 4.12E-01
Olive pollen allergy CA08.00 Peripheral blood 9.81E-02 3.98E-01 9.24E-01
Oral cancer 2B6E Oral tissue 4.07E-04 -8.91E-01 -7.97E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.48E-01 -2.70E-01 -3.14E-01
Osteoporosis FB83.1 Bone marrow 8.47E-02 2.40E-01 1.79E+00
Ovarian cancer 2C73 Ovarian tissue 8.58E-02 -7.00E-01 -8.39E-01
Pancreatic cancer 2C10 Pancreas 9.89E-01 -1.03E-01 -1.47E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.76E-01 -1.65E-01 -5.01E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.27E-02 1.72E-01 9.38E-01
Pituitary cancer 2D12 Pituitary tissue 8.06E-03 -3.56E-01 -6.73E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.14E-01 8.54E-02 2.44E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.45E-02 1.92E-01 9.36E-01
Polycythemia vera 2A20.4 Whole blood 2.63E-04 1.40E-01 5.86E-01
Pompe disease 5C51.3 Biceps muscle 2.25E-01 -3.00E-01 -9.98E-01
Preterm birth KA21.4Z Myometrium 1.83E-01 4.87E-02 2.85E-01
Prostate cancer 2C82 Prostate 3.70E-03 -9.68E-01 -9.05E-01
Psoriasis EA90 Skin 1.63E-01 -1.38E-01 -2.14E-01
Rectal cancer 2B92 Rectal colon tissue 1.25E-02 1.58E-01 1.26E+00
Renal cancer 2C90-2C91 Kidney 4.90E-01 9.05E-03 1.00E-02
Retinoblastoma 2D02.2 Uvea 1.36E-09 -1.27E+00 -3.38E+00
Rheumatoid arthritis FA20 Synovial tissue 2.60E-02 -6.39E-01 -1.28E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.52E-02 -1.02E-01 -3.56E-01
Schizophrenia 6A20 Prefrontal cortex 2.64E-01 8.29E-02 1.70E-01
Schizophrenia 6A20 Superior temporal cortex 3.24E-01 0.00E+00 0.00E+00
Scleroderma 4A42.Z Whole blood 1.79E-02 -5.15E-01 -1.14E+00
Seizure 8A60-8A6Z Whole blood 4.60E-01 -1.45E-01 -4.82E-01
Sensitive skin EK0Z Skin 1.96E-01 1.40E-01 6.49E-01
Sepsis with septic shock 1G41 Whole blood 3.14E-09 3.06E-01 4.72E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.51E-01 -1.05E-01 -1.94E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.80E-02 -4.58E-01 -1.65E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 2.15E-01 -2.00E-01 -1.25E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.93E-01 -4.71E-02 -1.43E-01
Skin cancer 2C30-2C3Z Skin 1.27E-10 -4.83E-01 -6.65E-01
Thrombocythemia 3B63 Whole blood 5.59E-03 1.87E-01 8.07E-01
Thrombocytopenia 3B64 Whole blood 3.95E-01 7.53E-01 7.06E-01
Thyroid cancer 2D10 Thyroid 9.23E-21 3.48E-01 1.16E+00
Tibial muscular dystrophy 8C75 Muscle tissue 7.04E-03 4.45E-01 8.29E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.89E-02 5.87E-01 2.44E+00
Type 2 diabetes 5A11 Liver tissue 8.87E-01 2.62E-01 8.51E-01
Ureter cancer 2C92 Urothelium 8.61E-01 1.44E-02 1.76E-02
Uterine cancer 2C78 Endometrium tissue 2.68E-07 -3.82E-01 -7.69E-01
Vitiligo ED63.0 Skin 8.48E-01 6.41E-03 2.14E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Generation of retinaldehyde for retinoic acid biosynthesis. Biomolecules. 2019 Dec 18;10(1). pii: E5.