Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DESIA7R)

DME Name Histo-blood group ABO system transferase (NAGAT)
Synonyms
Fucosylglycoprotein 3-alpha-galactosyltransferase; Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase soluble form; Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; Glycoprotein-fucosylgalactoside alpha-galactosyltransferase; Histo-blood group A transferase; Histo-blood group B transferase; NAGAT; A transferase; ABO; B transferase
Gene Name ABO
UniProt ID
BGAT_HUMAN
INTEDE ID
DME0552
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
28
EC Number EC: 2.4.1.40
Transferase
Glycosyltransferases
Hexosyltransferase
EC: 2.4.1.40
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDH
LQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTV
FAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKR
WQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSS
REAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVW
HDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
Function
This enzyme is the basis of the ABO blood group system. The histo-blood group ABO involves three carbohydrate antigens: A, B, and H. A, B, and AB individuals express a glycosyltransferase activity that converts the H antigen to the A antigen (by addition of UDP-GalNAc) or to the B antigen (by addition of UDP-Gal), whereas O individuals lack such activity.
KEGG Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series (hsa00601 )
Metabolic pathways (hsa01100 )
Reactome Pathway
ABO blood group biosynthesis (R-HSA-9033807 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Uridine Diphosphate Galactose DMPA0BJ Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Uridine Diphosphate Galactose Discovery agent [N.A.] Investigative Km = 0.027 microM [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.55E-01 6.84E-02 2.77E-01
Alopecia ED70 Skin from scalp 6.52E-01 -2.86E-03 -1.38E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.34E-01 -5.82E-02 -2.74E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.74E-01 -2.39E-02 -3.48E-01
Aortic stenosis BB70 Calcified aortic valve 8.88E-01 1.39E-01 1.26E-01
Apnea 7A40 Hyperplastic tonsil 3.58E-01 -4.13E-01 -7.81E-01
Arthropathy FA00-FA5Z Peripheral blood 7.94E-01 2.24E-02 1.14E-01
Asthma CA23 Nasal and bronchial airway 1.45E-01 -2.65E-01 -1.90E-01
Atopic dermatitis EA80 Skin 3.13E-02 2.24E-01 7.76E-01
Autism 6A02 Whole blood 2.99E-02 -2.54E-01 -7.59E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.12E-02 -3.08E-01 -2.00E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.45E-01 2.37E-01 6.91E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.62E-02 3.55E-02 6.47E-02
Batten disease 5C56.1 Whole blood 6.25E-01 6.34E-02 5.31E-01
Behcet's disease 4A62 Peripheral blood 2.12E-01 2.26E-01 3.53E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.27E-01 -5.01E-03 -2.16E-02
Bladder cancer 2C94 Bladder tissue 6.32E-01 3.18E-02 6.34E-02
Breast cancer 2C60-2C6Z Breast tissue 6.88E-01 -9.10E-02 -1.93E-01
Cardioembolic stroke 8B11.20 Whole blood 9.99E-01 1.02E-02 4.53E-02
Cervical cancer 2C77 Cervical tissue 8.36E-01 3.51E-02 1.13E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.74E-01 1.30E-01 4.01E-01
Chronic hepatitis C 1E51.1 Whole blood 9.41E-01 3.66E-02 2.34E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.81E-01 -1.20E-02 -2.10E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.63E-02 6.69E-02 1.08E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.28E-01 2.35E-01 8.13E-01
Colon cancer 2B90 Colon tissue 3.18E-30 -5.44E-01 -1.13E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.48E-01 9.60E-02 6.63E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.96E-01 -4.29E-02 -1.28E-01
Endometriosis GA10 Endometrium tissue 7.37E-01 -7.91E-02 -1.74E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.05E-01 -1.12E-01 -5.16E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.27E-02 -1.97E-01 -4.74E-01
Gastric cancer 2B72 Gastric tissue 4.29E-01 -2.69E-01 -7.74E-01
Glioblastopma 2A00.00 Nervous tissue 1.15E-78 -6.97E-01 -1.63E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.40E-01 -1.24E-01 -8.11E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.02E-03 -4.82E-01 -1.78E+00
Head and neck cancer 2D42 Head and neck tissue 1.95E-06 -1.87E-01 -3.94E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.74E-01 6.04E-03 1.86E-02
Huntington's disease 8A01.10 Whole blood 1.36E-01 1.94E-01 9.90E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.46E-01 3.28E-02 3.61E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.55E-01 9.26E-02 1.08E+00
Influenza 1E30 Whole blood 8.89E-02 1.80E-01 1.59E+00
Interstitial cystitis GC00.3 Bladder tissue 2.44E-01 2.55E-02 3.48E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.31E-01 -5.59E-02 -2.56E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.96E-03 -2.25E-01 -4.76E-01
Ischemic stroke 8B11 Peripheral blood 7.52E-02 5.37E-02 3.17E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.39E-01 -3.88E-02 -1.16E-01
Lateral sclerosis 8B60.4 Skin 1.82E-01 -1.44E-01 -8.91E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.59E-02 -8.80E-01 -1.91E+00
Liver cancer 2C12.0 Liver tissue 9.32E-04 -3.40E-01 -7.53E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.37E-02 -2.76E-01 -1.21E+00
Lung cancer 2C25 Lung tissue 1.29E-08 -1.48E-01 -3.18E-01
Lupus erythematosus 4A40 Whole blood 4.33E-02 6.54E-02 1.42E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.84E-01 6.41E-02 2.59E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.21E-01 -6.82E-02 -2.50E-01
Melanoma 2C30 Skin 1.12E-04 -3.32E-01 -1.07E+00
Multiple myeloma 2A83.1 Peripheral blood 9.14E-01 -7.95E-02 -2.76E-01
Multiple myeloma 2A83.1 Bone marrow 7.69E-01 8.07E-02 3.87E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.27E-01 1.03E-01 5.42E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.95E-01 -3.44E-02 -1.20E-01
Myelofibrosis 2A20.2 Whole blood 1.18E-02 1.89E-01 1.18E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.33E-01 -3.53E-02 -7.21E-02
Myopathy 8C70.6 Muscle tissue 5.81E-02 -2.39E-01 -9.05E-01
Neonatal sepsis KA60 Whole blood 8.54E-01 7.49E-03 1.44E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.02E-02 -1.18E-01 -4.82E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 9.46E-01 5.55E-02 2.82E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.46E-01 4.52E-02 2.08E-01
Olive pollen allergy CA08.00 Peripheral blood 1.95E-01 3.09E-01 8.96E-01
Oral cancer 2B6E Oral tissue 3.08E-07 -6.72E-01 -1.41E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.29E-01 -4.87E-01 -6.32E-01
Osteoporosis FB83.1 Bone marrow 4.18E-03 4.09E-01 6.11E+00
Ovarian cancer 2C73 Ovarian tissue 3.53E-01 -1.82E-01 -5.01E-01
Pancreatic cancer 2C10 Pancreas 9.66E-04 -5.51E-01 -1.08E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 3.64E-01 -1.14E-01 -2.49E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.67E-04 -2.16E-01 -9.90E-01
Pituitary cancer 2D12 Pituitary tissue 1.57E-03 4.56E-01 1.53E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.18E-02 3.87E-01 1.31E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.24E-01 4.94E-03 1.98E-02
Polycythemia vera 2A20.4 Whole blood 2.54E-15 3.91E-01 2.21E+00
Pompe disease 5C51.3 Biceps muscle 2.57E-01 -7.74E-02 -3.83E-01
Preterm birth KA21.4Z Myometrium 8.05E-01 8.74E-02 4.23E-01
Prostate cancer 2C82 Prostate 1.17E-02 1.84E-01 3.58E-01
Psoriasis EA90 Skin 3.81E-04 2.19E-01 5.53E-01
Rectal cancer 2B92 Rectal colon tissue 3.46E-01 -2.82E-01 -6.33E-01
Renal cancer 2C90-2C91 Kidney 1.18E-01 -1.53E-01 -2.55E-01
Retinoblastoma 2D02.2 Uvea 8.14E-09 -1.32E+00 -5.98E+00
Rheumatoid arthritis FA20 Synovial tissue 4.62E-02 -3.85E-01 -6.61E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.64E-01 2.44E-02 1.65E-01
Schizophrenia 6A20 Prefrontal cortex 9.22E-01 -3.07E-02 -9.03E-02
Schizophrenia 6A20 Superior temporal cortex 2.92E-01 -9.76E-02 -7.64E-01
Scleroderma 4A42.Z Whole blood 1.63E-02 3.39E-01 1.01E+00
Seizure 8A60-8A6Z Whole blood 8.55E-01 -7.46E-02 -3.12E-01
Sensitive skin EK0Z Skin 3.00E-01 -2.96E-02 -5.31E-01
Sepsis with septic shock 1G41 Whole blood 5.28E-01 3.33E-02 5.60E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.44E-01 -1.92E-03 -5.88E-03
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.95E-01 6.87E-02 3.74E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.68E-01 -1.99E-01 -6.08E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.74E-01 -3.03E-02 -1.06E-01
Skin cancer 2C30-2C3Z Skin 9.85E-02 4.86E-02 1.23E-01
Thrombocythemia 3B63 Whole blood 4.17E-11 3.31E-01 1.94E+00
Thrombocytopenia 3B64 Whole blood 3.54E-01 9.45E-02 1.66E-01
Thyroid cancer 2D10 Thyroid 8.68E-01 -4.44E-02 -8.29E-02
Tibial muscular dystrophy 8C75 Muscle tissue 9.44E-01 -2.13E-01 -3.13E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.29E-01 -1.31E-02 -1.21E-01
Type 2 diabetes 5A11 Liver tissue 2.09E-01 -1.43E-01 -6.01E-01
Ureter cancer 2C92 Urothelium 7.38E-01 4.66E-02 1.79E-01
Uterine cancer 2C78 Endometrium tissue 1.11E-03 -1.93E-01 -3.67E-01
Vitiligo ED63.0 Skin 2.12E-02 -1.23E-01 -9.93E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Structural basis for red cell phenotypic changes in newly identified, naturally occurring subgroup mutants of the human blood group B glycosyltransferase. Transfusion. 2007 May;47(5):864-75.
2 A single point mutation reverses the donor specificity of human blood group B-synthesizing galactosyltransferase. J Biol Chem. 2003 Apr 4;278(14):12403-5.