Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DESICUZ)

DME Name Retinol dehydrogenase 13 (RDH13)
Synonyms Dehydrogenase/reductase family 7C member 3; Short chain dehydrogenase/reductase family 7C member 3; PSEC0082; RDH13; SDR7C3; UNQ736/PRO1430
Gene Name RDH13
UniProt ID
RDH13_HUMAN
INTEDE ID
DME0474
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
112724
EC Number EC: 1.1.1.300
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.300
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSRYLLPLSALGTVAGAAVLLKDYVTGGACPSKATIPGKTVIVTGANTGIGKQTALELAR
RGGNIILACRDMEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDI
LINNAGVMRCPHWTTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAG
HIDFDDLNWQTRKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRH
TGIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEA
EDEEVARRLWAESARLVGLEAPSVREQPLPR
Function This enzyme has a clear preference for NADP. It oxidizes all-trans-retinol, but seems to reduce all-trans-retinal with much higher efficiency.
Reactome Pathway
RA biosynthesis pathway (R-HSA-5365859 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
NADH DM5NM6E Parkinson disease 8A00.0 Approved [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
NADH Parkinson disease [8A00.0] Approved Km = 6 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.29E-04 9.95E-02 4.29E-01
Alopecia ED70 Skin from scalp 6.83E-03 -1.82E-01 -6.72E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.77E-04 -7.33E-02 -4.70E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.75E-01 -7.20E-02 -7.24E-01
Aortic stenosis BB70 Calcified aortic valve 6.56E-01 1.75E-02 6.69E-02
Apnea 7A40 Hyperplastic tonsil 2.75E-01 4.53E-01 1.82E+00
Arthropathy FA00-FA5Z Peripheral blood 1.58E-01 -1.02E-01 -5.56E-01
Asthma CA23 Nasal and bronchial airway 5.83E-03 -1.05E-01 -4.02E-01
Atopic dermatitis EA80 Skin 3.42E-03 -1.91E-01 -8.24E-01
Autism 6A02 Whole blood 8.80E-01 8.73E-04 3.77E-03
Autoimmune uveitis 9A96 Peripheral monocyte 6.43E-01 6.18E-02 4.26E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.05E-02 7.14E-01 1.71E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.69E-12 -3.71E-01 -1.08E+00
Batten disease 5C56.1 Whole blood 2.88E-01 6.04E-02 1.80E-01
Behcet's disease 4A62 Peripheral blood 5.99E-01 -3.25E-02 -1.37E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.37E-01 -2.34E-02 -8.74E-02
Bladder cancer 2C94 Bladder tissue 4.32E-03 2.97E-01 1.17E+00
Breast cancer 2C60-2C6Z Breast tissue 8.14E-23 2.85E-01 7.44E-01
Cardioembolic stroke 8B11.20 Whole blood 6.88E-04 -1.85E-01 -1.04E+00
Cervical cancer 2C77 Cervical tissue 5.66E-02 -3.82E-01 -9.38E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.71E-01 1.81E-02 6.32E-02
Chronic hepatitis C 1E51.1 Whole blood 1.11E-01 -2.73E-01 -1.06E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 8.84E-01 -2.68E-02 -1.15E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.65E-03 -1.26E-01 -4.51E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.61E-01 -3.02E-02 -1.31E-01
Colon cancer 2B90 Colon tissue 5.69E-13 -1.89E-01 -6.69E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.15E-01 -2.66E-01 -6.98E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.91E-01 -1.87E-01 -4.32E-01
Endometriosis GA10 Endometrium tissue 1.17E-01 -6.13E-02 -1.44E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.79E-01 1.27E-01 5.87E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.29E-01 1.48E-01 7.39E-01
Gastric cancer 2B72 Gastric tissue 6.21E-01 -2.28E-01 -5.13E-01
Glioblastopma 2A00.00 Nervous tissue 3.44E-21 -1.74E-01 -6.97E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.46E-11 -5.46E-01 -2.41E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.23E-04 -2.59E-01 -1.30E+00
Head and neck cancer 2D42 Head and neck tissue 1.64E-11 -4.24E-01 -9.43E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.50E-01 5.89E-02 4.04E-01
Huntington's disease 8A01.10 Whole blood 4.35E-01 1.02E-01 7.03E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.43E-01 -1.40E-02 -1.12E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.12E-02 -1.33E-01 -1.07E+00
Influenza 1E30 Whole blood 5.82E-05 5.73E-01 9.30E+00
Interstitial cystitis GC00.3 Bladder tissue 2.40E-01 -1.79E-01 -6.56E-01
Intracranial aneurysm 8B01.0 Intracranial artery 8.68E-01 -1.22E-01 -3.94E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.86E-01 -3.62E-02 -1.61E-01
Ischemic stroke 8B11 Peripheral blood 3.41E-01 -3.44E-02 -1.46E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.62E-04 -1.41E-01 -5.41E-01
Lateral sclerosis 8B60.4 Skin 3.31E-01 -4.33E-02 -2.96E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.00E-01 4.84E-02 1.31E-01
Liver cancer 2C12.0 Liver tissue 6.58E-02 1.25E-01 3.72E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.47E-02 2.27E-01 8.97E-01
Lung cancer 2C25 Lung tissue 2.45E-13 1.52E-01 5.46E-01
Lupus erythematosus 4A40 Whole blood 6.20E-01 2.28E-02 6.89E-02
Major depressive disorder 6A70-6A7Z Hippocampus 9.36E-01 -8.50E-02 -3.21E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.02E-01 -3.39E-02 -1.64E-01
Melanoma 2C30 Skin 1.55E-01 -3.70E-01 -7.15E-01
Multiple myeloma 2A83.1 Peripheral blood 1.24E-01 -2.27E-01 -1.67E+00
Multiple myeloma 2A83.1 Bone marrow 6.59E-01 5.24E-02 1.49E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.72E-01 -7.43E-02 -3.41E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.42E-03 1.28E-01 5.59E-01
Myelofibrosis 2A20.2 Whole blood 7.38E-02 -5.22E-02 -4.43E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.17E-01 -2.97E-01 -5.53E-01
Myopathy 8C70.6 Muscle tissue 4.06E-01 -1.39E-02 -3.70E-02
Neonatal sepsis KA60 Whole blood 2.31E-11 -2.57E-01 -1.08E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.90E-03 -1.02E-01 -6.07E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 8.43E-01 2.48E-02 1.26E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.74E-02 -3.85E-01 -1.56E+00
Olive pollen allergy CA08.00 Peripheral blood 3.14E-01 -1.53E-01 -4.89E-01
Oral cancer 2B6E Oral tissue 2.35E-02 -3.11E-01 -9.19E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.81E-01 1.89E-01 5.92E-01
Osteoporosis FB83.1 Bone marrow 6.13E-01 8.37E-02 2.00E-01
Ovarian cancer 2C73 Ovarian tissue 5.60E-03 2.38E-01 6.55E-01
Pancreatic cancer 2C10 Pancreas 1.04E-01 -5.74E-02 -1.30E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.71E-01 -5.42E-02 -2.08E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.90E-01 5.01E-02 2.27E-01
Pituitary cancer 2D12 Pituitary tissue 4.25E-02 1.94E-01 1.22E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.70E-03 2.76E-01 1.88E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.77E-01 1.54E-01 6.70E-01
Polycythemia vera 2A20.4 Whole blood 2.59E-01 -2.15E-02 -1.55E-01
Pompe disease 5C51.3 Biceps muscle 1.72E-01 -6.25E-02 -3.27E-01
Preterm birth KA21.4Z Myometrium 7.94E-02 4.25E-01 1.01E+00
Prostate cancer 2C82 Prostate 1.64E-01 2.56E-02 6.91E-02
Psoriasis EA90 Skin 9.68E-01 -5.19E-02 -1.39E-01
Rectal cancer 2B92 Rectal colon tissue 5.55E-01 5.44E-02 1.82E-01
Renal cancer 2C90-2C91 Kidney 1.58E-01 1.94E-02 4.23E-02
Retinoblastoma 2D02.2 Uvea 9.20E-04 2.65E-01 1.71E+00
Rheumatoid arthritis FA20 Synovial tissue 4.59E-01 -9.55E-02 -5.20E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.55E-01 -5.38E-02 -3.53E-01
Schizophrenia 6A20 Prefrontal cortex 7.67E-01 -3.91E-02 -1.87E-01
Schizophrenia 6A20 Superior temporal cortex 1.75E-01 -7.98E-02 -8.78E-01
Scleroderma 4A42.Z Whole blood 2.11E-01 -3.63E-02 -1.57E-01
Seizure 8A60-8A6Z Whole blood 2.99E-01 1.56E-01 8.76E-01
Sensitive skin EK0Z Skin 9.78E-01 -8.01E-02 -3.61E-01
Sepsis with septic shock 1G41 Whole blood 2.35E-21 -2.35E-01 -9.93E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.34E-01 -6.86E-02 -7.91E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.34E-01 -1.76E-03 -8.99E-03
Simpson golabi behmel syndrome LD2C Adipose tissue 3.87E-01 -2.94E-01 -1.06E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.15E-01 1.43E-01 6.51E-01
Skin cancer 2C30-2C3Z Skin 3.86E-63 -9.34E-01 -1.99E+00
Thrombocythemia 3B63 Whole blood 2.42E-01 4.98E-02 3.94E-01
Thrombocytopenia 3B64 Whole blood 6.20E-01 4.77E-01 6.83E-01
Thyroid cancer 2D10 Thyroid 3.87E-24 -5.99E-01 -1.44E+00
Tibial muscular dystrophy 8C75 Muscle tissue 2.29E-01 -3.12E-01 -8.37E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.59E-02 -1.46E-01 -1.20E+00
Type 2 diabetes 5A11 Liver tissue 1.54E-01 -1.37E-01 -6.35E-01
Ureter cancer 2C92 Urothelium 7.56E-01 3.23E-03 8.15E-03
Uterine cancer 2C78 Endometrium tissue 1.29E-10 -5.05E-01 -9.77E-01
Vitiligo ED63.0 Skin 9.18E-01 -2.27E-02 -1.29E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Human retinol dehydrogenase 13 (RDH13) is a mitochondrial short-chain dehydrogenase/reductase with a retinaldehyde reductase activity. FEBS J. 2008 Jan;275(1):138-47.