General Information of Drug-Metabolizing Enzyme (DME) (ID: DESITDW)

DME Name Tartrate-resistant acid ATPase (ACP5)
Synonyms Tartrate-resistant acid phosphatase type 5; Type 5 acid phosphatase; TrATPase; ACP5; TR-AP
Gene Name ACP5
UniProt ID
PPA5_HUMAN
INTEDE ID
DME0230
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
54
EC Number EC: 3.1.3.2
Hydrolases
Ester bond hydrolase
Phosphoric monoester hydrolase
EC: 3.1.3.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQI
LGADFILSLGDNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ
IAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKL
ARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLRPLLATYGVTAYLCGH
DHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLGGFAYVEISSK
EMTVTYIEASGKSLFKTRLPRRARP
Function This enzyme is involved in osteopontin/bone sialoprotein dephosphorylation.
KEGG Pathway
Lysosome (hsa04142 )
Metabolic pathways (hsa01100 )
Osteoclast differentiation (hsa04380 )
Rheumatoid arthritis (hsa05323 )
Riboflavin metabolism (hsa00740 )
Reactome Pathway
Vitamin B2 (riboflavin) metabolism (R-HSA-196843 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Riboflavin DM8YMWE Acne vulgaris ED80 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.06E-04 -2.80E-01 -4.72E-01
Alopecia ED70 Skin from scalp 9.37E-03 -1.07E-01 -1.58E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.71E-02 4.41E-02 2.26E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.56E-01 2.32E-01 5.04E-01
Aortic stenosis BB70 Calcified aortic valve 4.53E-02 9.48E-01 1.17E+00
Apnea 7A40 Hyperplastic tonsil 2.81E-01 4.52E-01 2.02E+00
Arthropathy FA00-FA5Z Peripheral blood 3.60E-01 -4.38E-02 -1.21E-01
Asthma CA23 Nasal and bronchial airway 6.72E-01 1.02E-01 1.16E-01
Atopic dermatitis EA80 Skin 3.13E-01 6.09E-03 2.41E-02
Autism 6A02 Whole blood 8.62E-03 -3.24E-01 -6.87E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.12E-01 -1.95E-01 -4.07E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.81E-01 7.56E-02 1.02E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.82E-06 -2.33E-01 -7.32E-01
Batten disease 5C56.1 Whole blood 4.45E-01 -9.74E-02 -3.45E-01
Behcet's disease 4A62 Peripheral blood 8.42E-01 -2.65E-01 -7.41E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.10E-01 -4.42E-02 -2.13E-01
Bladder cancer 2C94 Bladder tissue 9.50E-03 2.06E-01 5.52E-01
Breast cancer 2C60-2C6Z Breast tissue 3.06E-27 5.67E-01 8.65E-01
Cardioembolic stroke 8B11.20 Whole blood 2.60E-11 -1.02E+00 -2.65E+00
Cervical cancer 2C77 Cervical tissue 8.18E-01 -1.20E-01 -2.11E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.10E-01 1.02E-01 1.77E-01
Chronic hepatitis C 1E51.1 Whole blood 3.85E-01 4.54E-02 1.41E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.75E-01 -6.91E-02 -1.03E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.24E-03 5.13E-01 5.60E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.83E-01 7.97E-01 5.98E-01
Colon cancer 2B90 Colon tissue 6.05E-13 -5.02E-01 -6.19E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.46E-01 -3.01E-01 -1.42E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.08E-02 -5.58E-01 -8.96E-01
Endometriosis GA10 Endometrium tissue 7.04E-01 -3.01E-01 -4.45E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.01E-01 5.89E-02 3.30E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.34E-02 -5.46E-01 -1.38E+00
Gastric cancer 2B72 Gastric tissue 3.10E-01 8.16E-01 6.42E-01
Glioblastopma 2A00.00 Nervous tissue 4.21E-20 1.13E-01 3.47E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.60E-01 -1.56E+00 -1.19E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.94E-01 1.29E-01 3.64E-01
Head and neck cancer 2D42 Head and neck tissue 1.88E-34 1.56E+00 2.12E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.68E-03 1.54E-01 8.69E-01
Huntington's disease 8A01.10 Whole blood 6.30E-01 7.60E-02 2.19E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.74E-02 7.65E-01 2.00E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.46E-03 3.19E-01 1.25E+00
Influenza 1E30 Whole blood 1.30E-01 5.45E-01 1.35E+00
Interstitial cystitis GC00.3 Bladder tissue 5.91E-05 1.56E+00 3.68E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.31E-03 3.11E+00 7.17E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.33E-01 -2.54E-01 -3.59E-01
Ischemic stroke 8B11 Peripheral blood 7.29E-01 -1.22E-01 -3.34E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.50E-02 -2.63E-01 -3.85E-01
Lateral sclerosis 8B60.4 Skin 2.45E-01 3.18E-01 1.20E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 5.95E-01 1.48E-01 4.91E-01
Liver cancer 2C12.0 Liver tissue 4.24E-03 -2.80E-01 -6.06E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.29E-08 3.15E+00 1.01E+01
Lung cancer 2C25 Lung tissue 9.53E-50 -1.33E+00 -1.59E+00
Lupus erythematosus 4A40 Whole blood 3.26E-02 -9.16E-02 -1.39E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.86E-01 -1.85E-02 -9.54E-02
Major depressive disorder 6A70-6A7Z Whole blood 5.88E-01 -7.32E-02 -1.41E-01
Melanoma 2C30 Skin 4.13E-03 5.86E-01 5.65E-01
Multiple myeloma 2A83.1 Peripheral blood 2.31E-02 4.57E-01 1.70E+00
Multiple myeloma 2A83.1 Bone marrow 5.08E-01 -9.35E-02 -1.18E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.57E-01 2.31E-01 6.83E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.02E-01 1.76E-01 2.60E-01
Myelofibrosis 2A20.2 Whole blood 9.88E-02 2.49E-01 1.06E+00
Myocardial infarction BA41-BA50 Peripheral blood 7.24E-01 2.21E-01 2.89E-01
Myopathy 8C70.6 Muscle tissue 1.54E-05 7.68E-01 3.34E+00
Neonatal sepsis KA60 Whole blood 1.15E-08 -5.27E-01 -1.21E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.64E-02 -7.32E-01 -1.09E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.49E-01 -3.38E-02 -1.19E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.68E-01 -4.61E-01 -1.36E+00
Olive pollen allergy CA08.00 Peripheral blood 3.15E-01 1.38E+00 8.91E-01
Oral cancer 2B6E Oral tissue 1.98E-05 8.70E-01 9.94E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.40E-01 1.17E-01 1.23E-01
Osteoporosis FB83.1 Bone marrow 9.34E-01 5.79E-02 1.33E-01
Ovarian cancer 2C73 Ovarian tissue 1.61E-01 1.65E-03 5.85E-03
Pancreatic cancer 2C10 Pancreas 6.58E-08 1.32E+00 2.24E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.37E-01 1.33E-02 7.59E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.28E-02 -1.22E-01 -4.96E-01
Pituitary cancer 2D12 Pituitary tissue 3.30E-01 7.02E-03 2.95E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.39E-02 -2.19E-01 -8.83E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.81E-01 4.63E-02 2.50E-01
Polycythemia vera 2A20.4 Whole blood 2.14E-07 1.93E-01 8.95E-01
Pompe disease 5C51.3 Biceps muscle 3.67E-03 8.57E-01 4.09E+00
Preterm birth KA21.4Z Myometrium 3.11E-01 -1.54E-01 -1.50E-01
Prostate cancer 2C82 Prostate 3.08E-04 -1.09E+00 -9.65E-01
Psoriasis EA90 Skin 2.68E-02 -2.52E-01 -2.41E-01
Rectal cancer 2B92 Rectal colon tissue 8.01E-01 -5.80E-02 -1.26E-01
Renal cancer 2C90-2C91 Kidney 1.81E-01 2.85E-01 2.05E-01
Retinoblastoma 2D02.2 Uvea 1.63E-04 1.22E+00 2.95E+00
Rheumatoid arthritis FA20 Synovial tissue 1.52E-01 1.12E+00 1.04E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.91E-01 3.55E-02 8.74E-02
Schizophrenia 6A20 Prefrontal cortex 3.83E-02 8.91E-02 9.33E-02
Schizophrenia 6A20 Superior temporal cortex 2.06E-01 -4.48E-02 -3.97E-01
Scleroderma 4A42.Z Whole blood 9.64E-01 -1.92E-02 -4.41E-02
Seizure 8A60-8A6Z Whole blood 1.76E-01 2.40E-01 8.61E-01
Sensitive skin EK0Z Skin 6.99E-01 -4.53E-02 -2.00E-01
Sepsis with septic shock 1G41 Whole blood 2.45E-18 -6.35E-01 -1.49E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.53E-01 3.35E-02 1.23E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.09E-01 4.64E-02 1.70E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.40E-01 1.02E-01 9.99E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.73E-01 -9.18E-02 -8.82E-01
Skin cancer 2C30-2C3Z Skin 4.46E-15 3.40E-01 3.62E-01
Thrombocythemia 3B63 Whole blood 5.00E-01 -1.35E-01 -5.60E-01
Thrombocytopenia 3B64 Whole blood 1.50E-01 4.38E-01 4.08E-01
Thyroid cancer 2D10 Thyroid 6.06E-15 1.68E+00 1.42E+00
Tibial muscular dystrophy 8C75 Muscle tissue 7.92E-08 1.06E+00 4.06E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.86E-02 3.22E-01 2.14E+00
Type 2 diabetes 5A11 Liver tissue 4.03E-01 3.79E-01 8.58E-01
Ureter cancer 2C92 Urothelium 4.63E-01 -1.05E-01 -5.44E-01
Uterine cancer 2C78 Endometrium tissue 1.55E-01 -1.61E-01 -1.68E-01
Vitiligo ED63.0 Skin 9.67E-01 -1.28E-01 -4.42E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 An atlas of human metabolism. Sci Signal. 2020 Mar 24;13(624). pii: eaaz1482. (Reaction HMR_6507)