Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DET89OV)

DME Name Thyroxine 5-deiodinase (DIO3)
Synonyms Iodothyronine deiodinase III; Type III iodothyronine deiodinase; Type 3 DI; 5DIII; DIO3; DIOIII; ITDI3; TXDI3
Gene Name DIO3
UniProt ID
IOD3_HUMAN
INTEDE ID
DME0535
Gene ID
1735
EC Number EC: 1.21.99.3
Oxidoreductase
X-H/Y-H oxidoreductase
X-H/Y-H oxidoreductase
EC: 1.21.99.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MPRQATSRLVVGEGEGSQGASGPAATMLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLW
LLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHG
QKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTUPPFMARMSAF
QRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYIIPQHRSLEDRVSAARVLQQGAPGCA
LVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGAR
PRRV
Function
This enzyme is responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into RT3 (3,3',5'-triiodothyronine) and of T3 (3,5,3'-triiodothyronine) into T2 (3,3'-diiodothyronine). RT3 and T2 are inactive metabolites.
KEGG Pathway
Thyroid hormone signaling pathway (hsa04919 )
Reactome Pathway
Regulation of thyroid hormone activity (R-HSA-350864 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-thyroxine DM83HWL N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.16E-03 8.38E-02 3.26E-01
Alopecia ED70 Skin from scalp 1.38E-03 -2.73E-01 -4.81E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.32E-01 9.99E-03 5.72E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 7.36E-01 -6.89E-02 -3.73E-01
Aortic stenosis BB70 Calcified aortic valve 6.98E-01 1.63E-01 1.96E-01
Apnea 7A40 Hyperplastic tonsil 2.12E-01 -2.14E-01 -9.43E-01
Arthropathy FA00-FA5Z Peripheral blood 1.24E-01 6.32E-02 7.54E-01
Asthma CA23 Nasal and bronchial airway 1.11E-01 -4.29E-02 -1.54E-01
Atopic dermatitis EA80 Skin 3.45E-04 -2.20E-01 -9.67E-01
Autism 6A02 Whole blood 9.48E-01 9.91E-02 3.33E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.10E-02 -7.57E-02 -7.20E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.52E-02 -2.10E-01 -1.35E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.05E-03 1.09E-01 4.49E-01
Batten disease 5C56.1 Whole blood 2.29E-01 1.74E-01 1.69E+00
Behcet's disease 4A62 Peripheral blood 9.25E-01 -1.55E-02 -6.94E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.01E-01 5.04E-02 2.87E-01
Bladder cancer 2C94 Bladder tissue 2.43E-03 -6.84E-01 -2.02E+00
Breast cancer 2C60-2C6Z Breast tissue 9.83E-04 -7.41E-02 -1.95E-01
Cardioembolic stroke 8B11.20 Whole blood 3.04E-01 4.97E-02 2.98E-01
Cervical cancer 2C77 Cervical tissue 1.14E-01 -7.94E-02 -3.19E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.11E-01 1.58E-03 5.77E-03
Chronic hepatitis C 1E51.1 Whole blood 5.24E-01 2.75E-02 1.75E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.42E-01 3.12E-02 1.05E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.38E-04 1.25E-01 4.57E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.29E-01 5.86E-02 1.78E-01
Colon cancer 2B90 Colon tissue 2.67E-03 -1.28E-01 -4.13E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.08E-01 -1.15E-01 -2.61E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.39E-01 -5.10E-02 -2.04E-01
Endometriosis GA10 Endometrium tissue 7.32E-01 8.32E-02 1.93E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.88E-01 4.30E-02 3.31E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.63E-01 -1.17E-01 -6.52E-01
Gastric cancer 2B72 Gastric tissue 1.21E-01 -3.31E-01 -1.99E+00
Glioblastopma 2A00.00 Nervous tissue 4.70E-14 -2.44E-01 -8.03E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.36E-02 2.26E-01 2.57E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.81E-01 -2.68E-01 -8.54E-01
Head and neck cancer 2D42 Head and neck tissue 7.03E-01 -1.34E-02 -6.26E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.70E-01 -6.93E-02 -3.37E-01
Huntington's disease 8A01.10 Whole blood 6.32E-01 6.84E-02 2.27E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.86E-02 -3.51E-01 -1.38E+00
Immunodeficiency 4A00-4A20 Peripheral blood 5.36E-01 -6.28E-02 -8.11E-01
Influenza 1E30 Whole blood 3.55E-01 1.90E-01 6.33E-01
Interstitial cystitis GC00.3 Bladder tissue 7.43E-01 -1.67E-01 -3.93E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.69E-01 -4.08E-01 -1.30E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.80E-02 -1.26E-01 -3.16E-01
Ischemic stroke 8B11 Peripheral blood 9.57E-02 -5.02E-02 -3.89E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.61E-02 7.60E-02 3.67E-01
Lateral sclerosis 8B60.4 Skin 4.26E-01 1.28E-01 1.32E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 4.55E-01 3.34E-02 1.11E-01
Liver cancer 2C12.0 Liver tissue 5.41E-05 -1.54E-01 -6.81E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.27E-01 -1.81E-01 -8.49E-01
Lung cancer 2C25 Lung tissue 5.33E-06 -9.54E-02 -4.01E-01
Lupus erythematosus 4A40 Whole blood 1.70E-01 -1.28E-01 -2.28E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.52E-01 -1.69E-02 -1.10E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.66E-03 7.60E-02 4.24E-01
Melanoma 2C30 Skin 1.50E-02 -3.22E-01 -8.67E-01
Multiple myeloma 2A83.1 Peripheral blood 7.86E-01 -6.49E-02 -3.26E-01
Multiple myeloma 2A83.1 Bone marrow 1.18E-02 2.24E-01 8.25E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.40E-01 1.26E-01 5.27E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.14E-01 3.37E-02 1.58E-01
Myelofibrosis 2A20.2 Whole blood 1.54E-01 -2.83E-02 -1.53E-01
Myocardial infarction BA41-BA50 Peripheral blood 6.24E-02 2.91E-01 8.00E-01
Myopathy 8C70.6 Muscle tissue 9.85E-02 -2.07E-01 -1.28E+00
Neonatal sepsis KA60 Whole blood 5.91E-01 -5.89E-03 -2.13E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.19E-01 -4.07E-01 -1.15E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.05E-01 2.10E-02 7.58E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.35E-01 -1.01E-01 -3.94E-01
Olive pollen allergy CA08.00 Peripheral blood 5.40E-01 9.06E-03 8.05E-02
Oral cancer 2B6E Oral tissue 2.88E-03 -3.90E-01 -9.61E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.80E-01 -3.51E-02 -1.32E-01
Osteoporosis FB83.1 Bone marrow 1.16E-01 2.59E-01 8.98E-01
Ovarian cancer 2C73 Ovarian tissue 1.17E-03 -1.07E+00 -2.07E+00
Pancreatic cancer 2C10 Pancreas 4.94E-01 -1.35E-01 -3.03E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.49E-01 2.78E-02 8.14E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.25E-01 -7.57E-02 -4.60E-01
Pituitary cancer 2D12 Pituitary tissue 3.61E-03 2.93E-01 8.74E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.01E-02 2.42E-01 7.56E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.31E-01 0.00E+00 0.00E+00
Polycythemia vera 2A20.4 Whole blood 2.84E-01 7.04E-03 3.90E-02
Pompe disease 5C51.3 Biceps muscle 6.43E-01 -2.35E-01 -6.79E-01
Preterm birth KA21.4Z Myometrium 1.38E-03 -3.33E+00 -2.80E+00
Prostate cancer 2C82 Prostate 1.02E-01 -2.47E-01 -3.35E-01
Psoriasis EA90 Skin 3.31E-18 -4.60E-01 -1.25E+00
Rectal cancer 2B92 Rectal colon tissue 1.92E-01 -2.30E-01 -8.61E-01
Renal cancer 2C90-2C91 Kidney 2.88E-01 -2.18E-01 -7.69E-01
Retinoblastoma 2D02.2 Uvea 7.34E-01 -1.53E-02 -9.48E-02
Rheumatoid arthritis FA20 Synovial tissue 5.14E-01 -1.40E-01 -7.77E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.06E-01 -5.53E-02 -4.40E-01
Schizophrenia 6A20 Prefrontal cortex 9.95E-01 -2.26E-02 -1.17E-01
Schizophrenia 6A20 Superior temporal cortex 5.45E-01 2.73E-03 2.45E-02
Scleroderma 4A42.Z Whole blood 1.82E-04 2.95E-01 2.03E+00
Seizure 8A60-8A6Z Whole blood 6.40E-02 -8.30E-02 -3.58E-01
Sensitive skin EK0Z Skin 1.84E-01 -1.07E-01 -4.88E-01
Sepsis with septic shock 1G41 Whole blood 1.12E-02 -1.03E-01 -3.34E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.58E-01 -1.38E-01 -8.19E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.15E-01 2.55E-02 7.65E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 2.29E-01 8.84E-02 1.48E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.02E-01 -1.38E-01 -3.18E-01
Skin cancer 2C30-2C3Z Skin 2.31E-37 -6.46E-01 -1.27E+00
Thrombocythemia 3B63 Whole blood 3.93E-01 1.18E-02 6.34E-02
Thrombocytopenia 3B64 Whole blood 2.51E-01 5.13E-01 1.47E+00
Thyroid cancer 2D10 Thyroid 2.96E-01 -6.82E-02 -2.59E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.24E-01 -9.61E-02 -3.98E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.48E-01 4.77E-02 6.89E-01
Type 2 diabetes 5A11 Liver tissue 5.42E-01 -1.33E-01 -8.27E-01
Ureter cancer 2C92 Urothelium 9.19E-01 -4.42E-02 -1.82E-01
Uterine cancer 2C78 Endometrium tissue 2.88E-16 -5.70E-01 -7.93E-01
Vitiligo ED63.0 Skin 5.88E-01 -2.53E-01 -4.03E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Substitution of cysteine for selenocysteine in the catalytic center of type III iodothyronine deiodinase reduces catalytic efficiency and alters substrate preference. Endocrinology. 2003 Jun;144(6):2505-13.