Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DETL4WB)

DME Name Cytochrome P450 8B1 (CYP8B1)
Synonyms
Cytochrome P450 family 8 subfamily B member 1; 7-alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase; 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase; CYP12; CYP8B1; CYPVIIIB1; Sterol 12-alpha-hydroxylase
Gene Name CYP8B1
UniProt ID
CP8B1_HUMAN
INTEDE ID
DME0631
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1582
EC Number EC: 1.14.18.8
Oxidoreductase
Oxygen paired donor oxidoreductase
Oxygen paired donor oxidoreductase
EC: 1.14.18.8
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MVLWGPVLGALLVVIAGYLCLPGMLRQRRPWEPPLDKGTVPWLGHAMAFRKNMFEFLKRM
RTKHGDVFTVQLGGQYFTFVMDPLSFGSILKDTQRKLDFGQYAKKLVLKVFGYRSVQGDH
EMIHSASTKHLRGDGLKDLNETMLDSLSFVMLTSKGWSLDASCWHEDSLFRFCYYILFTA
GYLSLFGYTKDKEQDLLQAGELFMEFRKFDLLFPRFVYSLLWPREWLEVGRLQRLFHKML
SVSHSQEKEGISNWLGNMLQFLREQGVPSAMQDKFNFMMLWASQGNTGPTSFWALLYLLK
HPEAIRAVREEATQVLGEARLETKQSFAFKLGALQHTPVLDSVVEETLRLRAAPTLLRLV
HEDYTLKMSSGQEYLFRHGDILALFPYLSVHMDPDIHPEPTVFKYDRFLNPNGSRKVDFF
KTGKKIHHYTMPWGSGVSICPGRFFALSEVKLFILLMVTHFDLELVDPDTPLPHVDPQRW
GFGTMQPSHDVRFRYRLHPTE
Function
This enzyme involves in bile acid synthesis and is responsible for the conversion of 7 alpha-hydroxy-4-cholesten-3-one into 7 alpha, 12 alpha-dihydroxy-4-cholesten-3-one. And it is responsible for the balance between formation of cholic acid and chenodeoxycholic acid. Has a rather broad substrate specificity including a number of 7-alpha-hydroxylated C27 steroids.
KEGG Pathway
Metabolic pathways (hsa01100 )
PPAR signaling pathway (hsa03320 )
Primary bile acid biosynthesis (hsa00120 )
Reactome Pathway
Nicotinamide salvaging (R-HSA-197264 )
Sterols are 12-hydroxylated by CYP8B1 (R-HSA-211994 )
Synthesis of Prostaglandins (PG) and Thromboxanes (TX) (R-HSA-2162123 )
Synthesis of bile acids and bile salts via 24-hydroxycholesterol (R-HSA-193775 )
Synthesis of bile acids and bile salts via 27-hydroxycholesterol (R-HSA-193807 )
Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol (R-HSA-193368 )
Eicosanoids (R-HSA-211979 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Chenodiol DMQ8JIK Cholelithiasis DC11 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.85E-03 -4.16E-02 -1.74E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.17E-01 -3.51E-03 -2.14E-02
Asthma CA23 Nasal and bronchial airway 2.88E-02 -1.06E-01 -2.30E-01
Behcet's disease 4A62 Peripheral blood 4.27E-01 7.55E-02 3.02E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.63E-01 -5.84E-03 -3.15E-02
Bladder cancer 2C94 Bladder tissue 1.68E-03 7.24E-01 2.02E+00
Breast cancer 2C60-2C6Z Breast tissue 1.19E-04 -8.17E-02 -3.48E-01
Colon cancer 2B90 Colon tissue 4.32E-01 -9.34E-02 -4.20E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.59E-03 -2.29E-01 -1.64E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.50E-01 -1.32E-01 -6.64E-01
Gastric cancer 2B72 Gastric tissue 1.42E-02 -2.76E-01 -4.29E+00
Glioblastopma 2A00.00 Nervous tissue 8.93E-01 -4.01E-02 -1.28E-01
Head and neck cancer 2D42 Head and neck tissue 1.37E-01 -2.32E-02 -1.29E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.46E-02 -6.25E-02 -2.35E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.54E-01 2.23E-02 1.25E-01
Interstitial cystitis GC00.3 Bladder tissue 7.69E-01 2.50E-03 3.86E-02
Ischemic stroke 8B11 Peripheral blood 1.43E-01 8.57E-02 4.49E-01
Liver cancer 2C12.0 Liver tissue 6.75E-44 -1.91E+00 -3.24E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.42E-03 -4.01E+00 -6.64E+00
Lung cancer 2C25 Lung tissue 8.50E-02 -3.04E-02 -1.54E-01
Lupus erythematosus 4A40 Whole blood 1.70E-02 -1.83E-01 -3.26E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.10E-01 5.18E-02 2.75E-01
Multiple myeloma 2A83.1 Bone marrow 1.23E-03 -5.38E-01 -2.01E+00
Multiple myeloma 2A83.1 Peripheral blood 4.62E-01 9.71E-02 4.54E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.17E-01 -1.04E-02 -2.70E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.81E-01 -3.63E-02 -1.22E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.81E-01 2.35E-01 3.55E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.12E-03 -7.75E-01 -1.26E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.55E-01 2.59E-02 7.64E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.30E-01 -4.36E-02 -4.41E-01
Olive pollen allergy CA08.00 Peripheral blood 1.25E-01 8.11E-02 7.46E-01
Oral cancer 2B6E Oral tissue 9.04E-02 -3.46E-01 -9.51E-01
Ovarian cancer 2C73 Ovarian tissue 8.22E-01 -2.98E-03 -1.02E-02
Pancreatic cancer 2C10 Pancreas 6.95E-01 -2.49E-01 -6.68E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.50E-01 3.71E-02 2.78E-01
Pituitary cancer 2D12 Pituitary tissue 5.26E-02 -1.16E-01 -5.73E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.44E-01 0.00E+00 0.00E+00
Pompe disease 5C51.3 Biceps muscle 1.29E-01 -1.07E-01 -6.58E-01
Prostate cancer 2C82 Prostate 3.69E-04 -8.86E-01 -1.29E+00
Psoriasis EA90 Skin 2.59E-06 -1.75E-01 -4.79E-01
Rectal cancer 2B92 Rectal colon tissue 8.06E-02 -1.60E-01 -7.95E-01
Renal cancer 2C90-2C91 Kidney 1.56E-02 -1.80E+00 -1.09E+00
Retinoblastoma 2D02.2 Uvea 1.11E-03 -2.86E-01 -2.08E+00
Schizophrenia 6A20 Prefrontal cortex 1.67E-01 8.96E-02 2.99E-01
Schizophrenia 6A20 Superior temporal cortex 6.71E-01 -4.25E-02 -3.38E-01
Scleroderma 4A42.Z Whole blood 6.61E-01 9.11E-02 4.45E-01
Seizure 8A60-8A6Z Whole blood 3.59E-01 -5.32E-02 -2.21E-01
Sepsis with septic shock 1G41 Whole blood 3.48E-07 2.25E-01 7.29E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.09E-01 4.04E-02 2.25E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.81E-01 -6.56E-02 -3.06E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.44E-01 1.92E-02 1.01E-01
Skin cancer 2C30-2C3Z Skin 1.67E-01 -1.03E-01 -2.40E-01
Thrombocythemia 3B63 Whole blood 9.96E-01 -4.21E-02 -2.59E-01
Thrombocytopenia 3B64 Whole blood 6.72E-01 0.00E+00 0.00E+00
Thyroid cancer 2D10 Thyroid 8.18E-02 2.23E-02 9.19E-02
Tibial muscular dystrophy 8C75 Muscle tissue 3.87E-01 5.88E-02 3.55E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.89E-03 2.14E-01 2.21E+00
Type 2 diabetes 5A11 Liver tissue 3.12E-02 1.29E-01 1.45E+00
Ureter cancer 2C92 Urothelium 9.05E-03 -1.64E-01 -8.08E-01
Uterine cancer 2C78 Endometrium tissue 6.21E-02 -8.99E-02 -2.51E-01
Vitiligo ED63.0 Skin 9.13E-01 -6.99E-02 -3.82E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 Conversion of chenodeoxycholic acid to cholic acid by human CYP8B1. Biol Chem. 2019 Apr 24;400(5):625-628.