Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DETYWG5)

DME Name UDP-N-acetylhexosamine pyrophosphorylase (AGX)
Synonyms UDP-N-acetylgalactosamine pyrophosphorylase; Sperm-associated antigen 2; UDP-N-acetylglucosamine pyrophosphorylase; AGX; AGX-1; AGX-2; Antigen X; SPAG2; UAP1
Gene Name UAP1
UniProt ID
UAP1_HUMAN
INTEDE ID
DME0537
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
6675
EC Number EC: 2.7.7.83
Transferase
Kinase
Nucleotidyltransferase
EC: 2.7.7.83
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MNINDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSS
HQKNVDARMEPVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAY
PKGMYDVGLPSRKTLFQIQAERILKLQQVAEKYYGNKCIIPWYIMTSGRTMESTKEFFTK
HKYFGLKKENVIFFQQGMLPAMSFDGKIILEEKNKVSMAPDGNGGLYRALAAQNIVEDME
QRGIWSIHVYCVDNILVKVADPRFIGFCIQKGADCGAKVVEKTNPTEPVGVVCRVDGVYQ
VVEYSEISLATAQKRSSDGRLLFNAGNIANHFFTVPFLRDVVNVYEPQLQHHVAQKKIPY
VDTQGQLIKPDKPNGIKMEKFVFDIFQFAKKFVVYEVLREDEFSPLKNADSQNGKDNPTT
ARHALMSLHHCWVLNAGGHFIDENGSRLPAIPRSATNGKSETITADVNHNLKDANDVPIQ
CEISPLISYAGEGLESYVADKEFHAPLIIDENGVHELVKNGI
Function
This enzyme converts UTP and GlcNAc-1-P into UDP-GlcNAc, and UTP and GalNAc-1-P into UDP-GalNAc. Isoform AGX1 has 2 to 3 times higher activity towards GalNAc-1-P, while isoform AGX2 has 8 times more activity towards GlcNAc-1-P.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Synthesis of UDP-N-acetyl-glucosamine (R-HSA-446210 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
NAG 1-phosphate DML7UVA N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.98E-03 -3.57E-02 -5.29E-02
Alopecia ED70 Skin from scalp 5.65E-05 1.44E-01 7.49E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.64E-03 -1.54E-01 -3.81E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.23E-01 -1.97E-01 -8.41E-01
Aortic stenosis BB70 Calcified aortic valve 9.95E-01 1.14E-01 6.24E-02
Apnea 7A40 Hyperplastic tonsil 3.00E-01 -5.43E-01 -4.42E-01
Arthropathy FA00-FA5Z Peripheral blood 8.86E-02 -2.30E-01 -6.28E-01
Asthma CA23 Nasal and bronchial airway 5.41E-10 5.05E-01 6.11E-01
Atopic dermatitis EA80 Skin 3.55E-01 4.86E-02 1.86E-01
Autism 6A02 Whole blood 5.13E-01 -1.27E-01 -2.30E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.57E-01 -6.20E-01 -1.03E+00
Autosomal dominant monocytopenia 4B04 Whole blood 6.31E-01 4.94E-01 6.07E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.31E-06 4.66E-01 8.34E-01
Batten disease 5C56.1 Whole blood 1.43E-01 1.60E-01 1.06E+00
Behcet's disease 4A62 Peripheral blood 5.45E-01 -1.64E-01 -6.01E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.23E-01 3.48E-02 1.28E-01
Bladder cancer 2C94 Bladder tissue 9.97E-01 2.88E-02 7.83E-02
Breast cancer 2C60-2C6Z Breast tissue 4.40E-24 4.23E-01 6.36E-01
Cardioembolic stroke 8B11.20 Whole blood 5.30E-04 -2.39E-01 -1.20E+00
Cervical cancer 2C77 Cervical tissue 6.64E-01 8.43E-03 1.39E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.73E-01 -3.60E-01 -4.78E-01
Chronic hepatitis C 1E51.1 Whole blood 9.30E-01 2.04E-01 2.63E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.59E-01 1.46E-03 1.81E-03
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.10E-05 -2.09E-01 -6.83E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.86E-01 -6.29E-01 -7.92E-01
Colon cancer 2B90 Colon tissue 2.62E-94 -7.97E-01 -2.94E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.33E-02 1.58E+00 2.57E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.20E-01 -1.36E-01 -2.54E-01
Endometriosis GA10 Endometrium tissue 4.80E-02 3.83E-01 7.46E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.73E-01 -3.28E-02 -8.75E-02
Familial hypercholesterolemia 5C80.00 Whole blood 6.88E-01 -3.04E-02 -6.99E-02
Gastric cancer 2B72 Gastric tissue 8.74E-01 -2.98E-01 -4.65E-01
Glioblastopma 2A00.00 Nervous tissue 6.46E-21 4.26E-01 5.29E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.85E-01 6.17E-02 6.95E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.39E-03 3.30E-01 1.00E+00
Head and neck cancer 2D42 Head and neck tissue 2.22E-09 -5.10E-01 -6.25E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.08E-01 -4.15E-02 -6.45E-02
Huntington's disease 8A01.10 Whole blood 9.68E-02 -5.58E-01 -1.15E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.05E-01 1.18E-01 1.44E-01
Immunodeficiency 4A00-4A20 Peripheral blood 6.24E-03 -2.72E-01 -1.71E+00
Influenza 1E30 Whole blood 1.01E-02 -8.96E-01 -3.58E+00
Interstitial cystitis GC00.3 Bladder tissue 4.36E-02 4.37E-01 1.48E+00
Intracranial aneurysm 8B01.0 Intracranial artery 6.70E-01 1.55E-02 1.80E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.43E-01 1.13E-02 6.87E-02
Ischemic stroke 8B11 Peripheral blood 8.53E-01 1.22E-01 2.60E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.81E-01 1.16E-01 2.08E-01
Lateral sclerosis 8B60.4 Skin 9.62E-01 1.51E-02 5.53E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 1.21E-01 -3.50E-01 -4.96E-01
Liver cancer 2C12.0 Liver tissue 8.82E-05 -3.44E-01 -7.26E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.55E-05 -9.99E-01 -3.42E+00
Lung cancer 2C25 Lung tissue 3.18E-12 5.84E-01 8.81E-01
Lupus erythematosus 4A40 Whole blood 8.53E-01 1.97E-01 2.21E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.25E-01 -3.93E-02 -1.73E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.72E-01 -7.44E-02 -1.95E-01
Melanoma 2C30 Skin 1.58E-01 -3.61E-01 -4.08E-01
Multiple myeloma 2A83.1 Peripheral blood 7.76E-01 2.01E-01 4.06E-01
Multiple myeloma 2A83.1 Bone marrow 4.60E-05 1.33E+00 3.13E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.67E-01 -1.07E-01 -3.47E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.07E-02 1.44E-01 4.07E-01
Myelofibrosis 2A20.2 Whole blood 3.97E-03 -3.37E-01 -9.87E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.37E-01 -3.98E-01 -3.59E-01
Myopathy 8C70.6 Muscle tissue 4.98E-02 -1.23E-01 -3.19E-01
Neonatal sepsis KA60 Whole blood 2.86E-02 -3.64E-01 -5.21E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.82E-06 2.60E+00 3.09E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.44E-03 7.29E-01 1.91E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.35E-01 1.04E-01 2.13E-01
Olive pollen allergy CA08.00 Peripheral blood 4.38E-02 -4.06E-01 -1.17E+00
Oral cancer 2B6E Oral tissue 1.64E-02 6.24E-01 6.67E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.00E-01 -2.39E-01 -2.44E-01
Osteoporosis FB83.1 Bone marrow 6.23E-02 -3.36E-01 -5.50E-01
Ovarian cancer 2C73 Ovarian tissue 8.48E-01 -4.57E-02 -4.15E-02
Pancreatic cancer 2C10 Pancreas 1.04E-01 -1.07E-01 -1.32E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.00E-01 -3.56E-01 -4.90E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.91E-01 1.52E-02 5.52E-02
Pituitary cancer 2D12 Pituitary tissue 4.04E-01 -1.83E-01 -2.86E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.61E-01 4.73E-02 1.13E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.52E-01 8.14E-02 4.61E-01
Polycythemia vera 2A20.4 Whole blood 1.61E-12 -4.85E-01 -1.38E+00
Pompe disease 5C51.3 Biceps muscle 8.00E-03 -4.88E-01 -2.40E+00
Preterm birth KA21.4Z Myometrium 2.35E-01 -1.18E+00 -1.81E+00
Prostate cancer 2C82 Prostate 1.79E-04 5.87E-01 7.53E-01
Psoriasis EA90 Skin 5.69E-05 -1.37E-01 -3.09E-01
Rectal cancer 2B92 Rectal colon tissue 9.67E-08 -7.98E-01 -5.23E+00
Renal cancer 2C90-2C91 Kidney 4.58E-04 7.14E-01 1.03E+00
Retinoblastoma 2D02.2 Uvea 8.06E-01 3.71E-02 1.36E-01
Rheumatoid arthritis FA20 Synovial tissue 4.54E-01 3.78E-01 4.49E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.52E-01 -6.28E-02 -4.03E-01
Schizophrenia 6A20 Prefrontal cortex 9.81E-02 -2.63E-01 -5.22E-01
Schizophrenia 6A20 Superior temporal cortex 6.91E-02 1.92E-01 5.83E-01
Scleroderma 4A42.Z Whole blood 9.75E-01 4.42E-03 1.88E-02
Seizure 8A60-8A6Z Whole blood 2.30E-01 5.51E-01 6.81E-01
Sensitive skin EK0Z Skin 8.97E-01 1.06E-01 5.68E-01
Sepsis with septic shock 1G41 Whole blood 3.07E-14 -6.22E-01 -1.07E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.32E-02 -7.18E-01 -1.61E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.83E-02 -4.36E-01 -5.49E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.09E-02 6.06E-01 1.61E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.57E-01 -2.42E-01 -1.39E+00
Skin cancer 2C30-2C3Z Skin 5.27E-03 2.02E-01 2.83E-01
Thrombocythemia 3B63 Whole blood 1.30E-03 -3.35E-01 -9.93E-01
Thrombocytopenia 3B64 Whole blood 2.12E-01 -8.23E-01 -7.99E-01
Thyroid cancer 2D10 Thyroid 1.30E-12 2.15E-01 7.97E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.37E-01 -2.46E-01 -4.67E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.05E-01 -4.30E-01 -5.40E+00
Type 2 diabetes 5A11 Liver tissue 4.25E-01 1.09E-01 6.71E-01
Ureter cancer 2C92 Urothelium 2.48E-01 1.02E-01 1.83E-01
Uterine cancer 2C78 Endometrium tissue 5.07E-04 3.26E-01 4.46E-01
Vitiligo ED63.0 Skin 5.96E-01 1.83E-01 4.86E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Crystal structures of two human pyrophosphorylase isoforms in complexes with UDPGlc(Gal)NAc: role of the alternatively spliced insert in the enzyme oligomeric assembly and active site architecture. EMBO J. 2001 Nov 15;20(22):6191-202.