Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEU2ZBY)

DME Name Peptide methionine sulfoxide reductase (MSRA)
Synonyms Peptide-methionine (S)-S-oxide reductase; Protein-methionine-S-oxide reductase; Mitochondrial peptide methionine sulfoxide reductase; Peptide Met(O) reductase; MSRA; PMSR
Gene Name MSRA
UniProt ID
MSRA_HUMAN
INTEDE ID
DME0188
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4482
EC Number EC: 1.8.4.11
Oxidoreductase
Sulfur donor oxidoreductase
Disulfide acceptor oxidoreductase
EC: 1.8.4.11
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEP
FPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVR
VVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQ
KVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Function This enzyme catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
Reactome Pathway
Protein repair (R-HSA-5676934 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-methionine DME8G1U Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.89E-47 -5.67E-01 -2.00E+00
Alopecia ED70 Skin from scalp 3.89E-01 4.40E-02 2.21E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.18E-05 -7.98E-02 -4.19E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.47E-01 1.25E-01 6.54E-01
Aortic stenosis BB70 Calcified aortic valve 1.05E-01 8.35E-02 4.76E-01
Apnea 7A40 Hyperplastic tonsil 2.46E-01 1.45E-01 8.89E-01
Arthropathy FA00-FA5Z Peripheral blood 8.13E-02 1.01E-01 6.04E-01
Asthma CA23 Nasal and bronchial airway 7.64E-05 1.33E-01 4.02E-01
Atopic dermatitis EA80 Skin 2.90E-01 4.01E-02 2.90E-01
Autism 6A02 Whole blood 2.08E-01 -7.78E-02 -2.94E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.27E-01 5.90E-02 4.15E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.88E-01 2.52E-01 8.00E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.63E-02 5.22E-02 3.56E-01
Batten disease 5C56.1 Whole blood 7.63E-01 -3.19E-02 -2.95E-01
Behcet's disease 4A62 Peripheral blood 1.06E-01 5.49E-02 3.90E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.03E-01 -1.40E-02 -8.19E-02
Bladder cancer 2C94 Bladder tissue 3.17E-01 -1.43E-01 -9.22E-01
Breast cancer 2C60-2C6Z Breast tissue 1.25E-106 -4.72E-01 -2.18E+00
Cardioembolic stroke 8B11.20 Whole blood 6.38E-08 3.18E-01 1.73E+00
Cervical cancer 2C77 Cervical tissue 1.98E-05 -1.83E-01 -1.25E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.16E-01 6.77E-02 1.94E-01
Chronic hepatitis C 1E51.1 Whole blood 7.31E-01 -9.63E-02 -5.29E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.45E-02 -7.26E-02 -5.27E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.79E-02 1.11E-01 7.33E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.11E-01 5.77E-03 9.43E-02
Colon cancer 2B90 Colon tissue 3.84E-50 -3.07E-01 -1.55E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.75E-01 5.99E-01 6.97E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.46E-01 -3.16E-02 -1.02E-01
Endometriosis GA10 Endometrium tissue 7.95E-02 -7.19E-02 -2.65E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.40E-02 8.10E-02 1.30E+00
Familial hypercholesterolemia 5C80.00 Whole blood 1.72E-02 7.94E-02 6.09E-01
Gastric cancer 2B72 Gastric tissue 5.33E-01 -4.15E-02 -2.10E-01
Glioblastopma 2A00.00 Nervous tissue 3.18E-04 -8.23E-02 -2.24E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.70E-01 6.32E-02 1.82E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.94E-07 1.12E+00 2.96E+00
Head and neck cancer 2D42 Head and neck tissue 2.33E-28 -3.34E-01 -2.18E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.26E-01 1.99E-01 7.60E-01
Huntington's disease 8A01.10 Whole blood 6.57E-01 -5.99E-02 -3.30E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.92E-01 2.95E-02 1.93E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.81E-01 -1.70E-03 -2.10E-02
Influenza 1E30 Whole blood 2.57E-01 -1.33E-01 -1.00E+00
Interstitial cystitis GC00.3 Bladder tissue 8.46E-01 2.35E-03 2.48E-02
Intracranial aneurysm 8B01.0 Intracranial artery 8.27E-01 3.95E-02 2.03E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.94E-01 -5.06E-02 -2.32E-01
Ischemic stroke 8B11 Peripheral blood 8.00E-02 7.27E-02 5.20E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.75E-01 8.45E-02 1.65E-01
Lateral sclerosis 8B60.4 Skin 5.11E-01 2.97E-03 1.93E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 3.91E-01 -7.14E-02 -1.43E-01
Liver cancer 2C12.0 Liver tissue 9.48E-31 -7.20E-01 -3.16E+00
Liver failure DB99.7-DB99.8 Liver tissue 6.29E-03 -6.54E-01 -2.53E+00
Lung cancer 2C25 Lung tissue 2.58E-52 -2.80E-01 -1.53E+00
Lupus erythematosus 4A40 Whole blood 1.80E-03 6.17E-02 2.43E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.67E-01 1.27E-01 8.73E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.99E-03 1.09E-01 3.79E-01
Melanoma 2C30 Skin 8.89E-01 -6.96E-02 -2.73E-01
Multiple myeloma 2A83.1 Peripheral blood 9.07E-01 -6.66E-03 -3.80E-02
Multiple myeloma 2A83.1 Bone marrow 2.54E-01 5.00E-02 3.36E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.21E-01 1.40E-01 1.04E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.39E-01 4.81E-02 3.40E-01
Myelofibrosis 2A20.2 Whole blood 2.91E-01 8.85E-02 8.37E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.58E-01 1.49E-01 2.12E-01
Myopathy 8C70.6 Muscle tissue 5.11E-04 1.67E-01 1.83E+00
Neonatal sepsis KA60 Whole blood 3.90E-19 4.18E-01 1.48E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.59E-02 1.80E-01 1.43E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.35E-01 1.62E-02 1.24E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.90E-02 8.24E-02 7.33E-01
Olive pollen allergy CA08.00 Peripheral blood 9.83E-03 4.68E-01 2.79E+00
Oral cancer 2B6E Oral tissue 5.93E-09 -3.17E-01 -1.53E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.82E-01 2.51E-02 2.30E-01
Osteoporosis FB83.1 Bone marrow 2.56E-01 -2.86E-02 -9.41E-02
Ovarian cancer 2C73 Ovarian tissue 5.55E-01 -1.61E-02 -6.12E-02
Pancreatic cancer 2C10 Pancreas 2.08E-02 -2.07E-01 -8.89E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.62E-01 -5.86E-02 -3.82E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.30E-01 5.60E-02 4.03E-01
Pituitary cancer 2D12 Pituitary tissue 6.71E-01 -2.15E-02 -1.67E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.80E-02 9.91E-02 6.32E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.14E-02 1.49E-01 1.02E+00
Polycythemia vera 2A20.4 Whole blood 2.13E-03 1.02E-01 9.04E-01
Pompe disease 5C51.3 Biceps muscle 2.91E-01 1.74E-01 1.17E+00
Preterm birth KA21.4Z Myometrium 9.20E-01 -5.95E-02 -3.06E-01
Prostate cancer 2C82 Prostate 2.64E-01 -1.18E-01 -3.46E-01
Psoriasis EA90 Skin 9.96E-12 -1.21E-01 -6.96E-01
Rectal cancer 2B92 Rectal colon tissue 4.32E-04 -5.66E-01 -3.02E+00
Renal cancer 2C90-2C91 Kidney 1.23E-02 -8.55E-01 -1.32E+00
Retinoblastoma 2D02.2 Uvea 4.76E-05 4.70E-01 6.06E+00
Rheumatoid arthritis FA20 Synovial tissue 1.11E-01 -9.65E-02 -8.66E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.98E-01 4.00E-02 4.36E-01
Schizophrenia 6A20 Prefrontal cortex 4.23E-02 -1.70E-01 -6.13E-01
Schizophrenia 6A20 Superior temporal cortex 6.84E-01 -1.74E-02 -1.29E-01
Scleroderma 4A42.Z Whole blood 5.65E-08 3.63E-01 4.24E+00
Seizure 8A60-8A6Z Whole blood 5.53E-01 -1.05E-01 -6.09E-01
Sensitive skin EK0Z Skin 5.73E-01 2.27E-02 2.19E-01
Sepsis with septic shock 1G41 Whole blood 3.49E-64 6.13E-01 2.20E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.44E-01 -8.83E-02 -2.99E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.36E-03 1.28E-01 6.85E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.13E-01 1.28E-01 9.47E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.31E-01 -1.25E-01 -1.17E+00
Skin cancer 2C30-2C3Z Skin 7.96E-02 6.56E-02 3.07E-01
Thrombocythemia 3B63 Whole blood 7.27E-01 -3.43E-03 -3.13E-02
Thrombocytopenia 3B64 Whole blood 2.40E-01 5.81E-01 1.24E+00
Thyroid cancer 2D10 Thyroid 1.22E-08 8.99E-02 6.59E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.96E-01 -9.22E-02 -3.00E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.02E-02 -2.18E-01 -1.84E+00
Type 2 diabetes 5A11 Liver tissue 7.36E-01 -5.26E-02 -2.76E-01
Ureter cancer 2C92 Urothelium 4.00E-01 -4.79E-02 -2.97E-01
Uterine cancer 2C78 Endometrium tissue 5.03E-14 -2.75E-01 -8.13E-01
Vitiligo ED63.0 Skin 5.25E-01 3.95E-02 1.76E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Characterization of the amino acids involved in substrate specificity of methionine sulfoxide reductase A. J Biol Chem. 2007 Jul 13;282(28):20484-91.