Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEUL532)

DME Name Choline glycerophosphodiester phosphodiesterase (ENPP6)
Synonyms
Glycerophosphocholine cholinephosphodiesterase ENPP6; Choline-specific glycerophosphodiester phosphodiesterase; Ectonucleotide pyrophosphatase/phosphodiesterase family member 6; GPC-Cpde; E-NPP 6; ENPP6; NPP-6; UNQ1889/PRO4334
Gene Name ENPP6
UniProt ID
ENPP6_HUMAN
INTEDE ID
DME0530
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
133121
EC Number EC: 3.1.4.3
Hydrolases
Ester bond hydrolase
Phosphoric diester hydrolase
EC: 3.1.4.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAVKLGTLLLALALGLAQPASARRKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKV
DYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGS
EPLWVTLTKAKRKVYMYYWPGCEVEILGVRPTYCLEYKNVPTDINFANAVSDALDSFKSG
RADLAAIYHERIDVEGHHYGPASPQRKDALKAVDTVLKYMTKWIQERGLQDRLNVIIFSD
HGMTDIFWMDKVIELNKYISLNDLQQVKDRGPVVSLWPAPGKHSEIYNKLSTVEHMTVYE
KEAIPSRFYYKKGKFVSPLTLVADEGWFITENREMLPFWMNSTGRREGWQRGWHGYDNEL
MDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWSRVMCMLKGRAST
APPVWPSHCALALILLFLLA
Function
This enzyme hydrolyzes glycerophosphocholine (GPC) and lysophosphatidylcholine (LPC) and contributes to supplying choline to the cells. It has a preference for LPC with short (12:0 and 14:0) or polyunsaturated (18:2 and 20:4) fatty acids. In vitro, it hydrolyzes only choline-containing lysophospholipids, such as sphingosylphosphorylcholine (SPC), platelet- activating factor (PAF) and lysoPAF, but not other lysophospholipids.
KEGG Pathway
Ether lipid metabolism (hsa00565 )
Reactome Pathway
Glycerophospholipid catabolism (R-HSA-6814848 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Cholini alfosceras DMVBQ20 N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.56E-02 -2.86E-02 -2.03E-01
Alopecia ED70 Skin from scalp 1.46E-04 7.71E-02 6.02E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.33E-01 -4.35E-02 -5.22E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 8.85E-01 2.35E-02 1.08E-01
Aortic stenosis BB70 Calcified aortic valve 2.57E-01 -9.16E-02 -4.77E-01
Apnea 7A40 Hyperplastic tonsil 3.09E-01 4.25E-02 6.95E-01
Arthropathy FA00-FA5Z Peripheral blood 5.84E-01 -2.73E-02 -2.48E-01
Asthma CA23 Nasal and bronchial airway 1.46E-01 1.11E-02 7.10E-02
Atopic dermatitis EA80 Skin 5.43E-01 -4.84E-03 -3.60E-02
Autism 6A02 Whole blood 9.56E-01 -7.10E-03 -5.45E-02
Autoimmune uveitis 9A96 Peripheral monocyte 7.44E-01 5.62E-02 5.04E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.64E-01 6.40E-02 5.69E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.30E-08 9.48E-02 6.50E-01
Batten disease 5C56.1 Whole blood 5.60E-01 -2.75E-03 -3.24E-02
Behcet's disease 4A62 Peripheral blood 3.95E-01 -1.01E-01 -7.15E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.65E-01 -9.03E-02 -2.27E-01
Bladder cancer 2C94 Bladder tissue 3.08E-03 -1.18E+00 -2.31E+00
Breast cancer 2C60-2C6Z Breast tissue 1.29E-24 -3.53E-01 -6.28E-01
Cardioembolic stroke 8B11.20 Whole blood 5.24E-10 2.04E-01 1.97E+00
Cervical cancer 2C77 Cervical tissue 6.46E-01 1.80E-02 1.01E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.73E-01 -2.43E-02 -1.88E-01
Chronic hepatitis C 1E51.1 Whole blood 6.66E-01 -1.55E-02 -9.30E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 1.82E-01 1.76E-02 1.50E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.02E-01 -1.23E-02 -1.13E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.65E-01 7.22E-02 6.06E-01
Colon cancer 2B90 Colon tissue 5.99E-44 -7.20E-01 -1.56E+00
Coronary artery disease BA80-BA8Z Peripheral blood 4.39E-01 -1.04E-01 -6.16E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.97E-01 2.69E-02 2.08E-01
Endometriosis GA10 Endometrium tissue 1.37E-03 2.13E-02 2.48E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.78E-01 -4.11E-02 -4.84E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.87E-03 -1.10E-01 -9.95E-01
Gastric cancer 2B72 Gastric tissue 1.42E-01 -3.48E-01 -2.30E+00
Glioblastopma 2A00.00 Nervous tissue 3.60E-23 -7.28E-01 -6.51E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.96E-01 -1.28E+00 -1.02E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.91E-01 -9.93E-02 -2.36E-01
Head and neck cancer 2D42 Head and neck tissue 1.63E-02 3.11E-02 1.97E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.59E-01 8.89E-02 6.01E-02
Huntington's disease 8A01.10 Whole blood 9.03E-01 1.99E-02 1.63E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.21E-01 3.63E-02 6.39E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.60E-01 -2.54E-02 -3.18E-01
Influenza 1E30 Whole blood 8.35E-03 2.18E-01 3.60E+00
Interstitial cystitis GC00.3 Bladder tissue 8.57E-03 -9.71E-01 -1.97E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.54E-03 3.23E+00 2.01E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.39E-01 -1.29E-01 -2.66E-01
Ischemic stroke 8B11 Peripheral blood 7.85E-01 1.98E-02 1.17E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.62E-02 7.53E-02 2.64E-01
Lateral sclerosis 8B60.4 Skin 2.10E-01 1.51E-01 1.17E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 5.37E-01 2.70E-02 2.83E-02
Liver cancer 2C12.0 Liver tissue 2.57E-02 -9.41E-03 -5.13E-02
Liver failure DB99.7-DB99.8 Liver tissue 2.70E-01 8.57E-02 6.72E-01
Lung cancer 2C25 Lung tissue 5.07E-09 -1.67E-01 -6.22E-01
Lupus erythematosus 4A40 Whole blood 4.78E-01 -1.88E-03 -1.15E-02
Major depressive disorder 6A70-6A7Z Hippocampus 2.33E-01 -4.73E-02 -1.28E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.02E-01 -6.81E-03 -3.25E-02
Melanoma 2C30 Skin 2.43E-01 -7.27E-02 -2.84E-01
Multiple myeloma 2A83.1 Peripheral blood 6.38E-01 -2.79E-02 -1.81E-01
Multiple myeloma 2A83.1 Bone marrow 2.47E-02 -1.79E-01 -1.49E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.52E-01 -6.23E-02 -3.59E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.23E-06 1.15E-02 9.56E-02
Myelofibrosis 2A20.2 Whole blood 6.98E-01 -8.97E-02 -7.88E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.48E-01 2.04E-02 6.97E-02
Myopathy 8C70.6 Muscle tissue 6.18E-02 3.17E-02 2.72E-01
Neonatal sepsis KA60 Whole blood 8.45E-01 1.38E-03 1.01E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.55E-09 -3.78E+00 -5.40E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.51E-01 -2.02E-03 -4.19E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.49E-01 -7.46E-02 -9.09E-01
Olive pollen allergy CA08.00 Peripheral blood 4.22E-01 1.78E-02 1.93E-01
Oral cancer 2B6E Oral tissue 8.50E-01 -2.66E-02 -8.74E-02
Osteoarthritis FA00-FA0Z Synovial tissue 3.82E-01 -1.79E-01 -3.99E-01
Osteoporosis FB83.1 Bone marrow 9.96E-01 0.00E+00 0.00E+00
Ovarian cancer 2C73 Ovarian tissue 6.81E-03 -2.63E+00 -1.68E+00
Pancreatic cancer 2C10 Pancreas 6.48E-01 -6.89E-02 -4.99E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.22E-01 -1.06E-01 -1.93E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.78E-01 1.87E-02 1.82E-01
Pituitary cancer 2D12 Pituitary tissue 1.93E-03 -1.11E+00 -1.14E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.79E-03 -1.20E+00 -1.09E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.54E-01 -2.02E-02 -2.12E-01
Polycythemia vera 2A20.4 Whole blood 4.35E-01 2.06E-02 1.77E-01
Pompe disease 5C51.3 Biceps muscle 4.20E-01 -1.11E-01 -7.37E-01
Preterm birth KA21.4Z Myometrium 9.20E-02 -1.57E-01 -1.11E+00
Prostate cancer 2C82 Prostate 7.00E-02 -6.18E-01 -8.63E-01
Psoriasis EA90 Skin 1.22E-05 -1.19E-01 -5.67E-01
Rectal cancer 2B92 Rectal colon tissue 2.40E-02 -7.92E-01 -1.17E+00
Renal cancer 2C90-2C91 Kidney 1.75E-03 -2.80E+00 -1.58E+00
Retinoblastoma 2D02.2 Uvea 4.74E-01 -4.21E-02 -6.03E-01
Rheumatoid arthritis FA20 Synovial tissue 5.23E-01 -1.41E-01 -3.12E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.74E-01 -4.58E-03 -4.57E-02
Schizophrenia 6A20 Prefrontal cortex 1.81E-03 -5.84E-01 -5.52E-01
Schizophrenia 6A20 Superior temporal cortex 2.03E-02 -2.74E-01 -8.67E-01
Scleroderma 4A42.Z Whole blood 1.85E-02 6.80E-02 5.93E-01
Seizure 8A60-8A6Z Whole blood 3.99E-01 0.00E+00 0.00E+00
Sensitive skin EK0Z Skin 8.74E-01 -1.35E-02 -1.17E-01
Sepsis with septic shock 1G41 Whole blood 8.15E-02 3.99E-02 2.47E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.84E-01 8.50E-02 1.10E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.83E-01 2.85E-02 2.12E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.71E-01 -1.26E-02 -1.27E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.82E-01 1.59E-01 1.10E+00
Skin cancer 2C30-2C3Z Skin 2.31E-01 -6.65E-02 -3.38E-01
Thrombocythemia 3B63 Whole blood 9.84E-01 4.30E-03 3.49E-02
Thrombocytopenia 3B64 Whole blood 1.56E-01 1.36E-01 7.67E-01
Thyroid cancer 2D10 Thyroid 2.18E-01 -2.97E-02 -1.38E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.08E-05 5.37E-01 2.73E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.85E-01 -6.22E-01 -9.70E-01
Type 2 diabetes 5A11 Liver tissue 8.81E-02 -1.19E-01 -1.95E+00
Ureter cancer 2C92 Urothelium 1.25E-02 -1.54E-01 -7.75E-01
Uterine cancer 2C78 Endometrium tissue 1.22E-03 3.08E-02 2.11E-01
Vitiligo ED63.0 Skin 1.50E-01 1.48E-01 1.35E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Biochemical and molecular characterization of a novel choline-specific glycerophosphodiester phosphodiesterase belonging to the nucleotide pyrophosphatase/phosphodiesterase family. J Biol Chem. 2005 Jun 17;280(24):23084-93.