General Information of Drug-Metabolizing Enzyme (DME) (ID: DEUPF5K)

DME Name Valyl-tRNA synthetase (VARS)
Synonyms Valine--tRNA ligase; Protein G7a; VARS1; VARS2; ValRS; VARS; G7A
Gene Name VARS1
UniProt ID
SYVC_HUMAN
INTEDE ID
DME0179
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
7407
EC Number EC: 6.1.1.9
Ligase
Carbon-oxygen ligase
Aminoacyl tRNA synthetase
EC: 6.1.1.9
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSTLYVSPHPDAFPSLRALIAARYGEAGEGPGWGGAHPRICLQPPPTSRTPFPPPRLPAL
EQGPGGLWVWGATAVAQLLWPAGLGGPGGSRAAVLVQQWVSYADTELIPAACGATLPALG
LRSSAQDPQAVLGALGRALSPLEEWLRLHTYLAGEAPTLADLAAVTALLLPFRYVLDPPA
RRIWNNVTRWFVTCVRQPEFRAVLGEVVLYSGARPLSHQPGPEAPALPKTAAQLKKEAKK
REKLEKFQQKQKIQQQQPPPGEKKPKPEKREKRDPGVITYDLPTPPGEKKDVSGPMPDSY
SPRYVEAAWYPWWEQQGFFKPEYGRPNVSAANPRGVFMMCIPPPNVTGSLHLGHALTNAI
QDSLTRWHRMRGETTLWNPGCDHAGIATQVVVEKKLWREQGLSRHQLGREAFLQEVWKWK
EEKGDRIYHQLKKLGSSLDWDRACFTMDPKLSAAVTEAFVRLHEEGIIYRSTRLVNWSCT
LNSAISDIEVDKKELTGRTLLSVPGYKEKVEFGVLVSFAYKVQGSDSDEEVVVATTRIET
MLGDVAVAVHPKDTRYQHLKGKNVIHPFLSRSLPIVFDEFVDMDFGTGAVKITPAHDQND
YEVGQRHGLEAISIMDSRGALINVPPPFLGLPRFEARKAVLVALKERGLFRGIEDNPMVV
PLCNRSKDVVEPLLRPQWYVRCGEMAQAASAAVTRGDLRILPEAHQRTWHAWMDNIREWC
ISRQLWWGHRIPAYFVTVSDPAVPPGEDPDGRYWVSGRNEAEAREKAAKEFGVSPDKISL
QQDEDVLDTWFSSGLFPLSILGWPNQSEDLSVFYPGTLLETGHDILFFWVARMVMLGLKL
TGRLPFREVYLHAIVRDAHGRKMSKSLGNVIDPLDVIYGISLQGLHNQLLNSNLDPSEVE
KAKEGQKADFPAGIPECGTDALRFGLCAYMSQGRDINLDVNRILGYRHFCNKLWNATKFA
LRGLGKGFVPSPTSQPGGHESLVDRWIRSRLTEAVRLSNQGFQAYDFPAVTTAQYSFWLY
ELCDVYLECLKPVLNGVDQVAAECARQTLYTCLDVGLRLLSPFMPFVTEELFQRLPRRMP
QAPPSLCVTPYPEPSECSWKDPEAEAALELALSITRAVRSLRADYNLTRIRPDCFLEVAD
EATGALASAVSGYVQALASAGVVAVLALGAPAPQGCAVALASDRCSIHLQLQGLVDPARE
LGKLQAKRVEAQRQAQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALF
QKML
Function This enzyme catalyzes the aminoacylation of tRNA by their cognate amino acid.
KEGG Pathway
Aminoacyl-tRNA biosynthesis (hsa00970 )
Reactome Pathway
Cytosolic tRNA aminoacylation (R-HSA-379716 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-valine DM68RPD Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.32E-26 3.74E-01 1.11E+00
Alopecia ED70 Skin from scalp 2.91E-01 -3.25E-02 -1.08E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.21E-04 -1.07E-01 -4.71E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.49E-02 1.37E-01 8.45E-01
Aortic stenosis BB70 Calcified aortic valve 1.65E-02 2.54E-01 8.90E-01
Apnea 7A40 Hyperplastic tonsil 1.79E-02 -3.79E-01 -2.23E+00
Arthropathy FA00-FA5Z Peripheral blood 1.63E-01 -7.66E-02 -6.18E-01
Asthma CA23 Nasal and bronchial airway 7.46E-01 2.14E-02 5.83E-02
Atopic dermatitis EA80 Skin 4.68E-02 1.67E-02 4.79E-02
Autism 6A02 Whole blood 6.08E-01 -5.76E-02 -2.79E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.12E-01 -1.90E-01 -8.99E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.49E-01 -1.65E-01 -1.84E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.40E-01 4.88E-02 1.20E-01
Batten disease 5C56.1 Whole blood 7.61E-01 -2.90E-02 -2.70E-01
Behcet's disease 4A62 Peripheral blood 7.22E-01 -1.41E-02 -4.19E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.42E-01 3.51E-03 2.26E-02
Bladder cancer 2C94 Bladder tissue 7.65E-03 5.95E-01 1.67E+00
Breast cancer 2C60-2C6Z Breast tissue 1.12E-46 3.71E-01 1.06E+00
Cardioembolic stroke 8B11.20 Whole blood 1.28E-02 -1.22E-01 -8.11E-01
Cervical cancer 2C77 Cervical tissue 2.94E-02 -1.75E-01 -6.10E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.45E-02 2.88E-01 6.36E-01
Chronic hepatitis C 1E51.1 Whole blood 5.44E-01 -9.26E-02 -5.66E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.05E-01 -2.13E-01 -5.38E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.83E-01 -9.33E-02 -2.30E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.03E-02 2.89E-01 1.05E+00
Colon cancer 2B90 Colon tissue 1.53E-26 4.63E-01 1.23E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.92E-01 -4.01E-02 -9.71E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.98E-01 5.79E-02 2.78E-01
Endometriosis GA10 Endometrium tissue 2.78E-01 2.75E-02 7.03E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.25E-01 6.25E-02 3.69E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.24E-05 6.28E-01 2.40E+00
Gastric cancer 2B72 Gastric tissue 3.36E-02 4.71E-01 2.54E+00
Glioblastopma 2A00.00 Nervous tissue 2.01E-08 1.34E-01 3.69E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.88E-01 -1.76E-02 -6.97E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.36E-05 6.76E-01 2.85E+00
Head and neck cancer 2D42 Head and neck tissue 1.84E-04 1.36E-01 4.57E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.52E-01 -5.54E-03 -1.64E-02
Huntington's disease 8A01.10 Whole blood 7.33E-01 8.31E-02 4.00E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.15E-03 4.17E-01 2.99E+00
Immunodeficiency 4A00-4A20 Peripheral blood 8.35E-02 4.58E-02 3.82E-01
Influenza 1E30 Whole blood 1.68E-02 -5.26E-01 -2.38E+00
Interstitial cystitis GC00.3 Bladder tissue 8.90E-01 5.97E-02 1.72E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.55E-01 2.62E-01 8.50E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.07E-01 2.36E-02 9.00E-02
Ischemic stroke 8B11 Peripheral blood 7.17E-02 -1.93E-01 -1.03E+00
Juvenile idiopathic arthritis FA24 Peripheral blood 1.26E-05 -2.28E-01 -8.57E-01
Lateral sclerosis 8B60.4 Skin 5.57E-01 1.62E-01 5.41E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.72E-02 3.52E-01 1.47E+00
Liver cancer 2C12.0 Liver tissue 1.06E-09 3.16E-01 1.04E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.30E-01 8.72E-02 2.60E-01
Lung cancer 2C25 Lung tissue 8.18E-50 4.67E-01 1.52E+00
Lupus erythematosus 4A40 Whole blood 2.00E-03 -1.71E-01 -3.80E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.27E-01 2.67E-02 1.59E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.10E-01 -7.44E-02 -2.05E-01
Melanoma 2C30 Skin 1.29E-01 4.13E-01 7.73E-01
Multiple myeloma 2A83.1 Peripheral blood 5.70E-01 -1.03E-01 -2.34E-01
Multiple myeloma 2A83.1 Bone marrow 3.59E-06 1.01E+00 4.42E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.09E-01 1.15E-01 4.34E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.67E-01 -5.44E-02 -1.64E-01
Myelofibrosis 2A20.2 Whole blood 1.14E-05 -2.06E-01 -1.65E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.23E-01 -1.02E-01 -3.36E-01
Myopathy 8C70.6 Muscle tissue 3.87E-01 1.10E-01 5.56E-01
Neonatal sepsis KA60 Whole blood 2.23E-02 -1.94E-01 -7.43E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.43E-04 4.58E-01 1.84E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.64E-01 -1.01E-01 -2.97E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.98E-01 9.77E-03 8.26E-02
Olive pollen allergy CA08.00 Peripheral blood 6.00E-01 -8.28E-02 -3.01E-01
Oral cancer 2B6E Oral tissue 5.20E-02 -7.62E-02 -2.00E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.93E-01 3.41E-01 4.42E-01
Osteoporosis FB83.1 Bone marrow 1.13E-01 4.21E-01 1.24E+00
Ovarian cancer 2C73 Ovarian tissue 5.56E-03 6.30E-01 1.55E+00
Pancreatic cancer 2C10 Pancreas 7.97E-01 1.63E-01 2.46E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.38E-02 -2.78E-01 -1.43E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.01E-01 8.91E-02 4.84E-01
Pituitary cancer 2D12 Pituitary tissue 2.81E-02 -4.15E-01 -2.17E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.29E-06 -7.56E-01 -4.74E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.10E-02 1.02E-01 6.53E-01
Polycythemia vera 2A20.4 Whole blood 1.54E-13 -2.50E-01 -1.96E+00
Pompe disease 5C51.3 Biceps muscle 7.36E-01 -4.77E-02 -2.31E-01
Preterm birth KA21.4Z Myometrium 5.51E-01 -1.05E-01 -4.92E-01
Prostate cancer 2C82 Prostate 7.16E-01 -2.01E-01 -5.12E-01
Psoriasis EA90 Skin 9.68E-01 -7.25E-02 -1.87E-01
Rectal cancer 2B92 Rectal colon tissue 6.26E-06 5.34E-01 3.99E+00
Renal cancer 2C90-2C91 Kidney 5.58E-01 4.98E-02 1.55E-01
Retinoblastoma 2D02.2 Uvea 9.02E-07 6.62E-01 3.35E+00
Rheumatoid arthritis FA20 Synovial tissue 2.02E-04 9.71E-01 3.24E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.86E-01 -4.19E-02 -2.78E-01
Schizophrenia 6A20 Prefrontal cortex 6.43E-01 3.44E-02 1.14E-01
Schizophrenia 6A20 Superior temporal cortex 1.62E-01 -6.64E-02 -5.35E-01
Scleroderma 4A42.Z Whole blood 3.50E-03 -1.70E-01 -1.81E+00
Seizure 8A60-8A6Z Whole blood 1.64E-01 2.42E-02 5.87E-02
Sensitive skin EK0Z Skin 2.72E-01 7.63E-02 4.29E-01
Sepsis with septic shock 1G41 Whole blood 9.59E-14 -1.97E-01 -8.21E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.26E-01 -2.94E-01 -1.68E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.62E-01 1.80E-01 8.12E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.24E-01 -1.39E-01 -5.08E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.07E-01 -3.05E-01 -2.03E+00
Skin cancer 2C30-2C3Z Skin 9.18E-11 3.79E-01 8.80E-01
Thrombocythemia 3B63 Whole blood 2.47E-04 -1.44E-01 -1.15E+00
Thrombocytopenia 3B64 Whole blood 5.16E-01 5.66E-01 6.76E-01
Thyroid cancer 2D10 Thyroid 2.46E-09 2.60E-01 9.95E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.69E-01 -4.14E-01 -8.24E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.24E-02 -2.49E-01 -1.93E+00
Type 2 diabetes 5A11 Liver tissue 1.76E-01 -2.45E-01 -7.23E-01
Ureter cancer 2C92 Urothelium 7.55E-01 -1.05E-02 -6.76E-02
Uterine cancer 2C78 Endometrium tissue 4.64E-09 -2.06E-01 -3.79E-01
Vitiligo ED63.0 Skin 9.77E-01 1.30E-02 1.08E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 A present-day aminoacyl-tRNA synthetase with ancestral editing properties. RNA. 2007 Jan;13(1):15-21.