General Information of Drug-Metabolizing Enzyme (DME) (ID: DEUWCVD)

DME Name Transglutaminase Y (TGM6)
Synonyms Protein-glutamine gamma-glutamyltransferase Y; Transglutaminase-6; Protein-glutamine gamma-glutamyltransferase 6; Transglutaminase-3-like; TGase-3-like; TGase-6; TGase Y; TG6; TGM3L; TGM6; TGY
Gene Name TGM6
UniProt ID
TGM3L_HUMAN
INTEDE ID
DME0164
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
343641
EC Number EC: 2.3.2.13
Transferase
Acyltransferase
Aminoacyltransferase
EC: 2.3.2.13
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAGIRVTKVDWQRSRNGAAHHTQEYPCPELVVRRGQSFSLTLELSRALDCEEILIFTMET
GPRASEALHTKAVFQTSELERGEGWTAAREAQMEKTLTVSLASPPSAVIGRYLLSIRLSS
HRKHSNRRLGEFVLLFNPWCAEDDVFLASEEERQEYVLSDSGIIFRGVEKHIRAQGWNYG
QFEEDILNICLSILDRSPGHQNNPATDVSCRHNPIYVTRVISAMVNSNNDRGVVQGQWQG
KYGGGTSPLHWRGSVAILQKWLKGRYKPVKYGQCWVFAGVLCTVLRCLGIATRVVSNFNS
AHDTDQNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQ
EESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWHEDESRERVYSNTKKI
GRCISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVNRLFGVEASGRRIWIRRAGGRC
LWRDDLLEPATKPSIAGKFKVLEPPMLGHDLRLALCLANLTSRAQRVRVNLSGATILYTR
KPVAEILHESHAVRLGPQEEKRIPITISYSKYKEDLTEDKKILLAAMCLVTKGEKLLVEK
DITLEDFITIKVLGPAMVGVAVTVEVTVVNPLIERVKDCALMVEGSGLLQEQLSIDVPTL
EPQERASVQFDITPSKSGPRQLQVDLVSPHFPDIKGFVIVHVATAK
Function This enzyme catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins.

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Taurine DMVW7N3 Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.08E-04 7.29E-02 3.02E-01
Alopecia ED70 Skin from scalp 2.52E-08 -4.50E-01 -1.42E+00
Alzheimer's disease 8A20 Entorhinal cortex 6.78E-01 6.30E-03 3.27E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 2.08E-01 -1.29E-02 -1.03E-01
Aortic stenosis BB70 Calcified aortic valve 3.76E-01 4.69E-01 6.42E-01
Apnea 7A40 Hyperplastic tonsil 3.20E-01 -2.20E-01 -1.20E+00
Arthropathy FA00-FA5Z Peripheral blood 7.21E-01 3.47E-03 2.08E-02
Asthma CA23 Nasal and bronchial airway 7.52E-03 -1.77E-01 -3.96E-01
Atopic dermatitis EA80 Skin 1.85E-02 1.03E-01 8.21E-01
Autism 6A02 Whole blood 3.31E-01 4.24E-02 1.46E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.46E-01 -1.20E-01 -8.77E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.55E-01 -5.86E-02 -3.83E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.63E-07 -2.83E-01 -7.79E-01
Batten disease 5C56.1 Whole blood 5.43E-01 -2.92E-02 -1.84E-01
Behcet's disease 4A62 Peripheral blood 9.21E-02 -1.35E-01 -5.59E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.03E-01 -2.89E-02 -1.28E-01
Bladder cancer 2C94 Bladder tissue 4.15E-04 5.28E-01 2.72E+00
Breast cancer 2C60-2C6Z Breast tissue 7.67E-01 -1.64E-02 -6.99E-02
Cardioembolic stroke 8B11.20 Whole blood 7.89E-01 -2.97E-02 -1.75E-01
Cervical cancer 2C77 Cervical tissue 9.34E-01 1.85E-02 7.63E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.86E-01 2.55E-02 9.55E-02
Chronic hepatitis C 1E51.1 Whole blood 5.38E-01 -5.39E-02 -3.43E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.96E-01 6.05E-02 2.76E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.86E-03 1.37E-01 4.81E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.27E-02 1.60E-01 1.46E+00
Colon cancer 2B90 Colon tissue 2.70E-24 -2.76E-01 -9.58E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.61E-01 4.66E-02 1.45E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.52E-01 -9.42E-02 -5.55E-01
Endometriosis GA10 Endometrium tissue 8.31E-01 9.69E-03 3.91E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.00E-01 -1.94E-02 -1.01E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.31E-01 1.96E-01 8.97E-01
Gastric cancer 2B72 Gastric tissue 3.06E-01 9.62E-02 7.61E-01
Glioblastopma 2A00.00 Nervous tissue 7.34E-31 -1.78E-01 -6.39E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.68E-01 -1.32E-01 -6.17E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.03E-05 -3.93E-01 -2.18E+00
Head and neck cancer 2D42 Head and neck tissue 3.55E-03 -1.01E-01 -4.07E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.51E-01 -1.06E-01 -5.41E-01
Huntington's disease 8A01.10 Whole blood 6.22E-01 5.98E-02 3.03E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.63E-01 6.74E-02 2.73E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.69E-01 -2.32E-02 -3.38E-01
Influenza 1E30 Whole blood 1.27E-01 3.67E-01 3.96E+00
Interstitial cystitis GC00.3 Bladder tissue 9.66E-01 0.00E+00 0.00E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.46E-01 -1.27E-01 -5.38E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.84E-01 1.29E-02 5.57E-02
Ischemic stroke 8B11 Peripheral blood 8.94E-01 -2.85E-02 -1.29E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.47E-03 1.29E-01 4.47E-01
Lateral sclerosis 8B60.4 Skin 6.28E-01 2.11E-01 1.04E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 3.52E-01 1.19E-01 8.75E-01
Liver cancer 2C12.0 Liver tissue 2.72E-07 -2.95E-01 -9.17E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.17E-01 -1.15E-01 -3.97E-01
Lung cancer 2C25 Lung tissue 4.79E-01 -1.89E-02 -8.51E-02
Lupus erythematosus 4A40 Whole blood 3.71E-05 -3.20E-01 -5.87E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.66E-01 2.54E-02 1.40E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.79E-03 8.91E-02 3.83E-01
Melanoma 2C30 Skin 7.94E-01 -1.33E-01 -1.94E-01
Multiple myeloma 2A83.1 Peripheral blood 6.69E-01 -2.52E-01 -7.09E-01
Multiple myeloma 2A83.1 Bone marrow 1.39E-01 -2.36E-01 -6.54E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.30E-01 1.27E-01 3.93E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.50E-01 5.00E-02 2.43E-01
Myelofibrosis 2A20.2 Whole blood 1.47E-01 5.86E-02 3.70E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.01E-02 1.47E-01 3.18E-01
Myopathy 8C70.6 Muscle tissue 2.33E-02 -2.48E-01 -9.17E-01
Neonatal sepsis KA60 Whole blood 6.81E-01 5.63E-02 1.82E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.22E-01 -9.68E-02 -2.98E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.44E-01 4.60E-02 1.55E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.22E-01 2.48E-02 5.65E-01
Olive pollen allergy CA08.00 Peripheral blood 3.66E-02 3.58E-01 1.74E+00
Oral cancer 2B6E Oral tissue 2.98E-04 -2.98E-01 -7.76E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.24E-01 -1.81E-01 -6.24E-01
Osteoporosis FB83.1 Bone marrow 9.29E-02 1.30E-01 1.05E+00
Ovarian cancer 2C73 Ovarian tissue 6.29E-01 5.84E-02 1.52E-01
Pancreatic cancer 2C10 Pancreas 2.15E-01 -5.84E-02 -1.64E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.85E-01 5.06E-03 1.98E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.94E-02 -1.13E-01 -5.65E-01
Pituitary cancer 2D12 Pituitary tissue 1.08E-01 1.82E-01 5.51E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.04E-01 0.00E+00 0.00E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.28E-01 -6.59E-02 -3.85E-01
Polycythemia vera 2A20.4 Whole blood 8.20E-01 -4.96E-03 -3.10E-02
Pompe disease 5C51.3 Biceps muscle 4.44E-01 -4.01E-02 -2.91E-01
Preterm birth KA21.4Z Myometrium 8.87E-02 -1.08E-01 -5.52E-01
Prostate cancer 2C82 Prostate 7.56E-03 -6.11E-01 -9.68E-01
Psoriasis EA90 Skin 2.53E-10 -2.62E-01 -5.04E-01
Rectal cancer 2B92 Rectal colon tissue 8.13E-02 -2.63E-01 -7.31E-01
Renal cancer 2C90-2C91 Kidney 1.01E-01 -7.15E-02 -1.65E-01
Retinoblastoma 2D02.2 Uvea 2.13E-03 -3.08E-01 -1.53E+00
Rheumatoid arthritis FA20 Synovial tissue 1.28E-01 -1.13E-01 -2.86E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.68E-01 1.30E-02 8.39E-02
Schizophrenia 6A20 Prefrontal cortex 7.67E-01 3.50E-02 1.48E-01
Schizophrenia 6A20 Superior temporal cortex 8.13E-01 -4.54E-02 -3.04E-01
Scleroderma 4A42.Z Whole blood 3.91E-01 6.57E-02 5.20E-01
Seizure 8A60-8A6Z Whole blood 2.99E-01 -1.48E-01 -7.61E-01
Sensitive skin EK0Z Skin 8.09E-01 -7.99E-03 -3.69E-02
Sepsis with septic shock 1G41 Whole blood 3.42E-01 1.25E-01 3.61E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.86E-01 4.13E-02 1.95E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.11E-01 1.43E-01 4.25E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.07E-01 -6.71E-02 -8.06E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.91E-01 -2.36E-01 -5.63E-01
Skin cancer 2C30-2C3Z Skin 8.05E-18 -4.31E-01 -6.71E-01
Thrombocythemia 3B63 Whole blood 6.66E-01 2.17E-03 1.41E-02
Thrombocytopenia 3B64 Whole blood 7.45E-01 2.25E-01 9.79E-01
Thyroid cancer 2D10 Thyroid 1.94E-04 1.15E-01 4.32E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.58E-06 -4.48E-01 -2.07E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.96E-01 2.49E-01 1.61E+00
Type 2 diabetes 5A11 Liver tissue 6.45E-01 -2.47E-02 -4.77E-01
Ureter cancer 2C92 Urothelium 5.94E-01 7.58E-03 2.99E-02
Uterine cancer 2C78 Endometrium tissue 7.93E-07 1.68E-01 5.54E-01
Vitiligo ED63.0 Skin 6.62E-01 1.31E-02 1.56E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 KEGG: new perspectives on genomes, pathways, diseases and drugs. Nucleic Acids Res. 2017 Jan 4;45(D1):D353-D361. (pathway:hsa00430)