Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEV0J5F)

DME Name Liver-type arginase (ARG1)
Synonyms Arginine amidinase 1; Canavanase 1; L-arginase 1; Arginine transamidinase 1; Arginase-1; Type I arginase; ARGAH1; ARG1
Gene Name ARG1
UniProt ID
ARGI1_HUMAN
INTEDE ID
DME0489
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
383
EC Number EC: 3.5.3.1
Hydrolases
Carbon-nitrogen hydrolase
Linear amidine hydrolase
EC: 3.5.3.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPN
DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT
LACFGLAREGNHKPIDYLNPPK
Function This enzyme is a key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides.
KEGG Pathway
Amoebiasis (hsa05146 )
Arginine and proline metabolism (hsa00330 )
Arginine biosynthesis (hsa00220 )
Biosynthesis of amino acids (hsa01230 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Urea cycle (R-HSA-70635 )
Neutrophil degranulation (R-HSA-6798695 )

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.66E-31 -3.76E-01 -1.56E+00
Alopecia ED70 Skin from scalp 8.69E-01 1.46E-01 1.54E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.50E-01 2.87E-03 2.28E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 1.02E-01 -9.16E-02 -7.08E-01
Aortic stenosis BB70 Calcified aortic valve 8.49E-01 1.49E-01 3.83E-01
Apnea 7A40 Hyperplastic tonsil 5.19E-01 -3.40E-02 -1.74E-01
Arthropathy FA00-FA5Z Peripheral blood 3.34E-02 8.29E-02 8.41E-01
Asthma CA23 Nasal and bronchial airway 4.19E-05 -8.84E-02 -2.78E-01
Atopic dermatitis EA80 Skin 2.53E-05 -7.31E-01 -9.93E-01
Autism 6A02 Whole blood 6.95E-01 2.28E-02 1.56E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.83E-01 6.99E-02 6.12E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.20E-01 3.01E-01 1.20E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.08E-01 -3.05E-02 -1.53E-01
Batten disease 5C56.1 Whole blood 6.96E-02 1.38E-01 1.10E+00
Behcet's disease 4A62 Peripheral blood 7.33E-01 -1.82E-02 -1.13E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.61E-01 -2.39E-03 -2.12E-02
Bladder cancer 2C94 Bladder tissue 1.56E-02 1.96E-01 8.96E-01
Breast cancer 2C60-2C6Z Breast tissue 1.48E-05 -5.25E-02 -2.75E-01
Cardioembolic stroke 8B11.20 Whole blood 5.56E-08 1.38E+00 1.88E+00
Cervical cancer 2C77 Cervical tissue 5.52E-02 -2.52E-01 -5.81E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.48E-01 2.16E-02 6.64E-02
Chronic hepatitis C 1E51.1 Whole blood 2.33E-01 -6.64E-02 -6.75E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.73E-01 7.43E-02 4.47E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.35E-01 2.04E-02 1.67E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.92E-01 5.52E-02 4.73E-01
Colon cancer 2B90 Colon tissue 2.64E-01 -7.36E-04 -5.02E-03
Coronary artery disease BA80-BA8Z Peripheral blood 7.24E-01 -4.88E-02 -5.94E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.09E-01 1.40E-02 1.13E-01
Endometriosis GA10 Endometrium tissue 3.48E-02 9.49E-02 5.55E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.10E-01 -6.85E-02 -5.28E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.10E-01 -6.65E-02 -5.28E-01
Gastric cancer 2B72 Gastric tissue 4.01E-01 1.35E-01 1.02E+00
Glioblastopma 2A00.00 Nervous tissue 6.87E-18 -9.30E-02 -4.87E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.72E-01 -5.41E-03 -1.35E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.17E-01 -3.84E-01 -3.31E-01
Head and neck cancer 2D42 Head and neck tissue 7.81E-01 -3.04E-03 -2.07E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.65E-03 -1.56E-01 -8.11E-01
Huntington's disease 8A01.10 Whole blood 4.32E-01 -5.04E-02 -3.93E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.76E-03 -3.90E-01 -2.41E+00
Immunodeficiency 4A00-4A20 Peripheral blood 8.61E-01 5.11E-02 4.96E-01
Influenza 1E30 Whole blood 7.53E-02 2.46E-01 3.53E+00
Interstitial cystitis GC00.3 Bladder tissue 4.14E-01 1.11E-02 9.57E-02
Intracranial aneurysm 8B01.0 Intracranial artery 8.53E-01 6.67E-02 5.46E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.50E-01 -8.81E-03 -3.89E-02
Ischemic stroke 8B11 Peripheral blood 2.64E-01 -3.25E-02 -2.43E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.28E-06 1.37E-01 3.24E-01
Lateral sclerosis 8B60.4 Skin 8.81E-01 -2.96E-02 -1.21E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 6.88E-01 2.60E-03 1.80E-02
Liver cancer 2C12.0 Liver tissue 1.26E-06 -1.03E+00 -9.23E-01
Liver failure DB99.7-DB99.8 Liver tissue 5.51E-03 -4.94E-01 -1.00E+00
Lung cancer 2C25 Lung tissue 5.27E-11 -9.87E-02 -5.36E-01
Lupus erythematosus 4A40 Whole blood 3.70E-04 1.83E-01 2.35E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.55E-02 7.25E-02 6.33E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.05E-05 3.01E-01 6.93E-01
Melanoma 2C30 Skin 1.62E-01 2.24E-02 2.91E-02
Multiple myeloma 2A83.1 Peripheral blood 1.94E-01 6.24E-02 6.27E-01
Multiple myeloma 2A83.1 Bone marrow 4.07E-02 -2.00E-01 -8.79E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.41E-01 1.24E-01 4.34E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.85E-01 3.18E-02 1.62E-01
Myelofibrosis 2A20.2 Whole blood 7.73E-01 -1.77E-02 -1.61E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.27E-02 1.21E-01 3.37E-01
Myopathy 8C70.6 Muscle tissue 8.89E-02 -1.23E-01 -1.05E+00
Neonatal sepsis KA60 Whole blood 8.53E-24 4.21E-01 3.00E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.24E-01 -4.85E-02 -2.30E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 5.54E-02 2.72E-01 4.68E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.17E-01 3.94E-02 7.96E-01
Olive pollen allergy CA08.00 Peripheral blood 2.98E-02 1.23E-01 1.21E+00
Oral cancer 2B6E Oral tissue 4.22E-05 -2.33E-01 -1.16E+00
Osteoarthritis FA00-FA0Z Synovial tissue 3.00E-01 -1.16E-01 -7.64E-01
Osteoporosis FB83.1 Bone marrow 5.62E-01 -1.01E-02 -1.29E-01
Ovarian cancer 2C73 Ovarian tissue 7.22E-02 -1.18E-01 -7.91E-01
Pancreatic cancer 2C10 Pancreas 3.60E-01 -1.46E-01 -6.19E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.89E-01 1.02E-01 8.07E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.33E-01 3.31E-02 2.65E-01
Pituitary cancer 2D12 Pituitary tissue 2.85E-01 -1.21E-02 -1.34E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.53E-01 -6.03E-02 -4.52E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.96E-01 -7.95E-02 -7.71E-01
Polycythemia vera 2A20.4 Whole blood 1.20E-02 9.59E-02 9.07E-01
Pompe disease 5C51.3 Biceps muscle 1.28E-02 -1.15E-01 -9.04E-01
Preterm birth KA21.4Z Myometrium 7.10E-01 -2.26E-02 -1.13E-01
Prostate cancer 2C82 Prostate 9.41E-01 -4.12E-02 -2.08E-01
Psoriasis EA90 Skin 2.33E-31 1.02E+00 1.33E+00
Rectal cancer 2B92 Rectal colon tissue 4.05E-01 -7.96E-02 -6.31E-01
Renal cancer 2C90-2C91 Kidney 6.45E-02 -2.17E-01 -1.07E+00
Retinoblastoma 2D02.2 Uvea 5.28E-02 -1.06E-01 -8.06E-01
Rheumatoid arthritis FA20 Synovial tissue 1.71E-01 -6.21E-02 -3.49E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.35E-01 -1.73E-02 -1.92E-01
Schizophrenia 6A20 Prefrontal cortex 4.17E-01 2.66E-02 1.41E-01
Schizophrenia 6A20 Superior temporal cortex 6.75E-01 6.62E-02 9.39E-01
Scleroderma 4A42.Z Whole blood 6.02E-07 1.66E-01 2.36E+00
Seizure 8A60-8A6Z Whole blood 2.27E-01 -6.38E-02 -3.43E-01
Sensitive skin EK0Z Skin 4.88E-01 1.35E-01 4.44E-01
Sepsis with septic shock 1G41 Whole blood 7.89E-101 6.09E-01 3.20E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.33E-01 -1.90E-01 -5.05E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.97E-01 -7.76E-03 -7.06E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 2.54E-01 5.59E-02 1.18E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.06E-01 -7.11E-02 -5.26E-01
Skin cancer 2C30-2C3Z Skin 2.60E-05 -5.08E-01 -7.12E-01
Thrombocythemia 3B63 Whole blood 1.72E-01 8.94E-03 7.91E-02
Thrombocytopenia 3B64 Whole blood 3.60E-01 9.30E-02 4.93E-01
Thyroid cancer 2D10 Thyroid 4.42E-01 -4.35E-02 -2.69E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.35E-05 -2.70E-01 -2.19E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.41E-01 3.30E-03 4.89E-02
Type 2 diabetes 5A11 Liver tissue 6.57E-01 -1.20E-01 -2.76E-01
Ureter cancer 2C92 Urothelium 3.15E-01 -1.98E-02 -1.56E-01
Uterine cancer 2C78 Endometrium tissue 1.91E-02 8.18E-02 3.20E-01
Vitiligo ED63.0 Skin 6.53E-01 -2.19E-01 -3.99E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases