Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEVDR46)

DME Name Pyrrolidone-carboxylate peptidase (PGPI)
Synonyms Pyroglutamyl aminopeptidase I; Pyroglutamyl-peptidase 1; 5-oxoprolyl-peptidase; Pyroglutamyl-peptidase I; PAP-I; PGP-I; PGPEP1; PGPI
Gene Name PGPEP1
UniProt ID
PGPI_HUMAN
INTEDE ID
DME0549
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
54858
EC Number EC: 3.4.19.3
Hydrolases
Peptidase
Omega peptidase
EC: 3.4.19.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPA
LWEKHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSII
DMDAVCKRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQ
LGRALRAIIEEMLDLLEQSEGKINYCHKH
Function This enzyme removes 5-oxoproline from various penultimate amino acid residues except L-proline.

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
protirelin DMGN5QD Central nervous system disease 8A04-8D87 Approved [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
protirelin Central nervous system disease [8A04-8D87] Approved Km = 0.046 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.08E-22 3.01E-01 1.10E+00
Alopecia ED70 Skin from scalp 1.49E-02 -4.71E-02 -1.98E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.18E-04 1.67E-01 7.39E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.54E-02 2.20E-01 1.42E+00
Aortic stenosis BB70 Calcified aortic valve 7.14E-01 -7.06E-03 -2.70E-02
Apnea 7A40 Hyperplastic tonsil 1.85E-01 2.51E-01 7.71E-01
Arthropathy FA00-FA5Z Peripheral blood 4.63E-01 4.30E-03 4.08E-02
Asthma CA23 Nasal and bronchial airway 2.03E-02 6.35E-02 2.19E-01
Atopic dermatitis EA80 Skin 1.61E-01 2.31E-02 1.31E-01
Autism 6A02 Whole blood 3.27E-01 -1.45E-01 -5.91E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.85E-01 -1.95E-01 -1.09E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.05E-03 7.97E-01 3.05E+00
Bacterial infection of gingival 1C1H Gingival tissue 5.20E-27 4.89E-01 2.15E+00
Batten disease 5C56.1 Whole blood 8.88E-01 -6.78E-03 -4.41E-02
Behcet's disease 4A62 Peripheral blood 9.30E-02 -1.01E-01 -6.67E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.98E-01 5.85E-02 2.14E-01
Bladder cancer 2C94 Bladder tissue 7.04E-03 -3.64E-01 -1.61E+00
Breast cancer 2C60-2C6Z Breast tissue 1.58E-08 -1.22E-01 -3.86E-01
Cardioembolic stroke 8B11.20 Whole blood 8.24E-01 5.32E-02 3.18E-01
Cervical cancer 2C77 Cervical tissue 3.94E-01 2.59E-02 8.11E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.68E-01 5.81E-02 2.81E-01
Chronic hepatitis C 1E51.1 Whole blood 3.50E-01 -5.46E-02 -3.62E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.35E-01 -9.83E-03 -5.94E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.68E-03 -6.56E-02 -2.61E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.96E-01 -6.16E-02 -2.71E-01
Colon cancer 2B90 Colon tissue 1.14E-36 -4.40E-01 -1.35E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.04E-01 1.08E-01 9.56E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.60E-01 -1.57E-01 -3.31E-01
Endometriosis GA10 Endometrium tissue 7.86E-01 1.74E-01 3.02E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.86E-02 -1.13E-01 -8.93E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.61E-02 -8.42E-02 -5.29E-01
Gastric cancer 2B72 Gastric tissue 1.36E-01 -4.51E-01 -1.48E+00
Glioblastopma 2A00.00 Nervous tissue 3.84E-04 1.19E-01 2.70E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.45E-02 -2.66E-01 -2.81E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.84E-02 -1.69E-01 -5.84E-01
Head and neck cancer 2D42 Head and neck tissue 7.73E-15 -5.68E-01 -1.23E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.27E-01 1.47E-02 9.65E-02
Huntington's disease 8A01.10 Whole blood 2.32E-01 1.30E-01 9.72E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.88E-01 1.20E-01 4.99E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.65E-01 -4.19E-02 -4.38E-01
Influenza 1E30 Whole blood 5.94E-01 5.66E-02 2.81E+00
Interstitial cystitis GC00.3 Bladder tissue 4.70E-03 -3.98E-01 -2.35E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.66E-02 3.47E-01 1.08E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.15E-02 -1.29E-01 -5.00E-01
Ischemic stroke 8B11 Peripheral blood 2.85E-01 -4.16E-02 -2.99E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.90E-01 3.89E-02 1.81E-01
Lateral sclerosis 8B60.4 Skin 5.39E-01 8.23E-02 7.95E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.10E-01 9.38E-02 2.61E-01
Liver cancer 2C12.0 Liver tissue 4.34E-02 -9.42E-02 -2.55E-01
Liver failure DB99.7-DB99.8 Liver tissue 9.16E-01 4.90E-02 1.27E-01
Lung cancer 2C25 Lung tissue 2.99E-01 -1.98E-02 -9.30E-02
Lupus erythematosus 4A40 Whole blood 1.59E-01 -1.73E-02 -6.36E-02
Major depressive disorder 6A70-6A7Z Hippocampus 3.61E-01 -1.19E-01 -4.45E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.02E-01 -1.53E-02 -7.71E-02
Melanoma 2C30 Skin 3.04E-01 1.92E-01 3.42E-01
Multiple myeloma 2A83.1 Peripheral blood 6.16E-01 2.10E-01 5.44E-01
Multiple myeloma 2A83.1 Bone marrow 1.08E-02 2.91E-01 1.24E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.01E-01 -1.88E-02 -7.91E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.62E-07 2.95E-01 1.17E+00
Myelofibrosis 2A20.2 Whole blood 1.88E-01 -4.67E-02 -7.18E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.29E-01 1.44E-02 5.05E-02
Myopathy 8C70.6 Muscle tissue 5.84E-01 -7.39E-02 -2.68E-01
Neonatal sepsis KA60 Whole blood 2.44E-08 1.90E-01 9.54E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.05E-09 -1.32E+00 -5.45E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.56E-01 -1.73E-01 -4.76E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.89E-02 1.49E-01 4.73E-01
Olive pollen allergy CA08.00 Peripheral blood 1.67E-01 1.15E-01 6.25E-01
Oral cancer 2B6E Oral tissue 1.18E-04 -4.57E-01 -8.05E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.07E-01 8.21E-02 3.21E-01
Osteoporosis FB83.1 Bone marrow 1.88E-01 1.16E-01 5.82E-01
Ovarian cancer 2C73 Ovarian tissue 1.23E-01 -4.92E-02 -1.62E-01
Pancreatic cancer 2C10 Pancreas 2.32E-02 -3.70E-01 -1.12E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 4.37E-02 1.66E-01 8.17E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.38E-02 1.13E-01 7.97E-01
Pituitary cancer 2D12 Pituitary tissue 1.13E-05 -5.31E-01 -1.93E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.47E-05 -5.72E-01 -2.45E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.09E-01 3.23E-02 2.56E-01
Polycythemia vera 2A20.4 Whole blood 3.56E-01 2.40E-02 3.22E-01
Pompe disease 5C51.3 Biceps muscle 3.15E-01 1.52E-01 4.69E-01
Preterm birth KA21.4Z Myometrium 6.77E-02 8.41E-02 3.89E-01
Prostate cancer 2C82 Prostate 1.73E-06 2.45E-01 9.63E-01
Psoriasis EA90 Skin 1.52E-04 -9.14E-02 -4.29E-01
Rectal cancer 2B92 Rectal colon tissue 1.12E-02 -3.61E-01 -1.93E+00
Renal cancer 2C90-2C91 Kidney 1.44E-02 -4.51E-01 -6.49E-01
Retinoblastoma 2D02.2 Uvea 6.66E-10 1.25E+00 5.39E+00
Rheumatoid arthritis FA20 Synovial tissue 3.61E-02 5.34E-01 1.46E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.89E-04 -9.27E-02 -5.95E-01
Schizophrenia 6A20 Prefrontal cortex 3.75E-01 7.97E-02 2.07E-01
Schizophrenia 6A20 Superior temporal cortex 9.01E-01 1.21E-02 8.08E-02
Scleroderma 4A42.Z Whole blood 7.27E-02 7.65E-02 7.06E-01
Seizure 8A60-8A6Z Whole blood 3.38E-01 -1.11E-01 -6.89E-01
Sensitive skin EK0Z Skin 4.40E-01 -1.30E-01 -1.02E+00
Sepsis with septic shock 1G41 Whole blood 2.66E-37 1.79E-01 1.15E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.60E-01 1.45E-01 6.83E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.24E-03 4.39E-01 1.52E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 5.18E-01 8.72E-02 6.61E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.98E-02 -3.14E-01 -2.39E+00
Skin cancer 2C30-2C3Z Skin 4.45E-49 6.11E-01 1.88E+00
Thrombocythemia 3B63 Whole blood 8.52E-01 -3.23E-02 -4.18E-01
Thrombocytopenia 3B64 Whole blood 7.06E-01 2.56E-01 2.35E-01
Thyroid cancer 2D10 Thyroid 2.08E-20 3.68E-01 1.92E+00
Tibial muscular dystrophy 8C75 Muscle tissue 7.10E-03 -3.85E-01 -1.06E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.27E-02 7.02E-01 4.70E+00
Type 2 diabetes 5A11 Liver tissue 3.65E-01 -2.64E-01 -1.09E+00
Ureter cancer 2C92 Urothelium 4.11E-01 1.43E-02 9.77E-02
Uterine cancer 2C78 Endometrium tissue 7.42E-12 -2.71E-01 -6.22E-01
Vitiligo ED63.0 Skin 6.07E-02 -2.51E-01 -1.19E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Marginal involvement of pyroglutamyl aminopeptidase I in metabolism of thyrotropin-releasing hormone in rat brain. Biol Pharm Bull. 2004 Aug;27(8):1197-201.