Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEVON3M)

DME Name Aldo-keto reductase 1D1 (AKR1D1)
Synonyms Aldo-keto reductase family 1 member D1; Delta(4)-3-ketosteroid 5-beta-reductase; Delta(4)-3-oxosteroid 5-beta-reductase; SRD5B1; 3-oxo-5-beta-steroid 4-dehydrogenase; AKR1D1
Gene Name AKR1D1
UniProt ID
AK1D1_HUMAN
INTEDE ID
DME0400
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
6718
EC Number EC: 1.3.1.3
Oxidoreductase
CH-CH donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.3.1.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQN
EHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIE
VPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELIL
NKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLK
DALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIE
ALNKNVRFVELLMWRDHPEYPFHDEY
Function
This enzyme catalyzes the stereospecific NADPH-dependent reduction of the C4-C5 double bond of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure to yield an A/B cis-ring junction. This cis-configuration plays important roles in steroid metabolism. It is also capable of reducing a broad range of delta-(4)-3-ketosteroids from C18 (such as, 17beta- hydroxyestr-4-en-3-one) to C27 (such as, 7alpha-hydroxycholest-4-en-3-one).
KEGG Pathway
Metabolic pathways (hsa01100 )
Primary bile acid biosynthesis (hsa00120 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Synthesis of bile acids and bile salts via 27-hydroxycholesterol (R-HSA-193807 )
Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol (R-HSA-193368 )
Synthesis of bile acids and bile salts via 24-hydroxycholesterol (R-HSA-193775 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Norethindrone acetate DMDGCQP N. A. N. A. Approved [1]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Hydroxy-cholesten-one DM6IEKW N. A. N. A. Investigative [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.25E-01 -1.13E-02 -8.85E-02
Alopecia ED70 Skin from scalp 1.91E-02 6.91E-02 3.00E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.23E-01 4.44E-03 3.98E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 4.28E-01 2.42E-02 2.28E-01
Aortic stenosis BB70 Calcified aortic valve 8.53E-01 -1.74E-01 -2.94E-01
Apnea 7A40 Hyperplastic tonsil 9.82E-01 2.26E-02 1.62E-01
Arthropathy FA00-FA5Z Peripheral blood 4.89E-01 0.00E+00 0.00E+00
Asthma CA23 Nasal and bronchial airway 1.07E-01 -4.20E-02 -1.69E-01
Atopic dermatitis EA80 Skin 3.76E-01 2.49E-02 2.19E-01
Autism 6A02 Whole blood 1.41E-01 -6.07E-02 -4.03E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.45E-01 1.94E-01 1.12E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.51E-01 6.29E-03 4.52E-02
Bacterial infection of gingival 1C1H Gingival tissue 2.07E-01 -3.12E-02 -2.38E-01
Batten disease 5C56.1 Whole blood 5.82E-03 -1.19E-01 -2.42E+00
Behcet's disease 4A62 Peripheral blood 5.52E-01 -6.78E-02 -2.80E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.12E-01 -2.35E-02 -2.41E-01
Bladder cancer 2C94 Bladder tissue 1.90E-01 4.81E-02 2.79E-01
Breast cancer 2C60-2C6Z Breast tissue 2.04E-04 -3.78E-02 -2.64E-02
Cardioembolic stroke 8B11.20 Whole blood 5.77E-01 1.24E-01 5.01E-01
Cervical cancer 2C77 Cervical tissue 9.83E-01 -6.89E-02 -3.39E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.44E-02 2.99E-02 3.16E-01
Chronic hepatitis C 1E51.1 Whole blood 1.51E-02 1.39E-01 1.20E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 3.62E-02 2.35E-02 3.07E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.30E-01 7.90E-03 7.72E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.73E-01 1.08E-02 9.74E-02
Colon cancer 2B90 Colon tissue 1.65E-07 5.22E-02 4.07E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.13E-01 2.73E-02 1.71E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.67E-01 -3.14E-02 -3.86E-01
Endometriosis GA10 Endometrium tissue 8.81E-01 -5.02E-03 -3.45E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.73E-01 -1.03E-02 -2.24E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.67E-03 -1.78E-01 -1.17E+00
Gastric cancer 2B72 Gastric tissue 5.05E-03 1.03E-01 2.39E+00
Glioblastopma 2A00.00 Nervous tissue 1.19E-04 3.70E-02 2.31E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.56E-01 -4.41E-02 -3.78E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.10E-01 -8.49E-02 -3.73E-01
Head and neck cancer 2D42 Head and neck tissue 9.57E-02 -7.68E-03 -8.28E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.02E-01 2.09E-02 6.62E-02
Huntington's disease 8A01.10 Whole blood 3.01E-01 -3.70E-02 -6.59E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.67E-01 2.73E-02 3.00E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.63E-03 8.86E-02 9.11E-01
Influenza 1E30 Whole blood 1.63E-01 1.71E-01 1.60E+00
Interstitial cystitis GC00.3 Bladder tissue 4.42E-01 1.51E-02 1.49E-01
Intracranial aneurysm 8B01.0 Intracranial artery 8.66E-01 8.05E-03 5.28E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.80E-02 9.35E-02 2.99E-01
Ischemic stroke 8B11 Peripheral blood 9.20E-01 -2.22E-02 -1.88E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.25E-01 -1.88E-02 -7.08E-02
Lateral sclerosis 8B60.4 Skin 6.61E-01 -5.40E-02 -3.10E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.28E-01 3.54E-02 1.23E-01
Liver cancer 2C12.0 Liver tissue 3.44E-20 -3.59E+00 -2.47E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.18E-03 -4.34E+00 -5.76E+00
Lung cancer 2C25 Lung tissue 1.38E-02 1.47E-02 1.23E-01
Lupus erythematosus 4A40 Whole blood 6.22E-05 7.89E-02 3.45E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.69E-01 -2.21E-02 -2.32E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.12E-02 3.32E-02 2.08E-01
Melanoma 2C30 Skin 3.56E-03 -1.99E-01 -5.02E-01
Multiple myeloma 2A83.1 Peripheral blood 7.92E-01 -7.82E-03 -5.64E-02
Multiple myeloma 2A83.1 Bone marrow 4.35E-01 -1.85E-01 -1.03E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.02E-01 3.67E-02 1.18E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.44E-01 6.32E-03 7.58E-02
Myelofibrosis 2A20.2 Whole blood 4.47E-01 -5.21E-03 -2.80E-02
Myocardial infarction BA41-BA50 Peripheral blood 2.10E-01 -6.35E-02 -4.51E-02
Myopathy 8C70.6 Muscle tissue 4.66E-01 5.30E-02 4.79E-01
Neonatal sepsis KA60 Whole blood 3.42E-01 -1.91E-02 -1.35E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.26E-01 -7.90E-02 -5.21E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.48E-02 8.54E-01 1.34E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.19E-01 9.06E-02 1.07E+00
Olive pollen allergy CA08.00 Peripheral blood 8.14E-02 5.50E-02 6.34E-01
Oral cancer 2B6E Oral tissue 3.28E-01 -8.14E-02 -4.23E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.27E-01 4.65E-03 1.91E-02
Osteoporosis FB83.1 Bone marrow 5.17E-01 0.00E+00 0.00E+00
Ovarian cancer 2C73 Ovarian tissue 8.13E-01 -3.47E-02 -1.96E-01
Pancreatic cancer 2C10 Pancreas 3.05E-01 -1.28E-01 -6.61E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.00E-01 -4.37E-02 -8.60E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.95E-01 -7.58E-03 -7.46E-02
Pituitary cancer 2D12 Pituitary tissue 9.45E-01 -5.12E-04 -4.13E-03
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.27E-01 -4.17E-02 -2.93E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.26E-01 3.11E-02 4.20E-01
Polycythemia vera 2A20.4 Whole blood 2.26E-01 1.32E-02 7.93E-02
Pompe disease 5C51.3 Biceps muscle 5.51E-01 -5.82E-02 -3.76E-01
Preterm birth KA21.4Z Myometrium 1.10E-01 -7.69E-02 -6.43E-01
Prostate cancer 2C82 Prostate 4.04E-01 2.74E-02 6.85E-02
Psoriasis EA90 Skin 1.24E-01 -2.12E-02 -1.22E-01
Rectal cancer 2B92 Rectal colon tissue 1.31E-01 -2.55E-01 -1.01E+00
Renal cancer 2C90-2C91 Kidney 5.71E-02 2.48E-03 1.78E-02
Retinoblastoma 2D02.2 Uvea 9.29E-01 1.52E-02 3.20E-01
Rheumatoid arthritis FA20 Synovial tissue 1.74E-01 -2.63E-01 -8.11E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.09E-01 -2.06E-02 -1.83E-01
Schizophrenia 6A20 Prefrontal cortex 9.64E-02 1.87E-02 1.75E-01
Schizophrenia 6A20 Superior temporal cortex 2.93E-01 3.15E-02 3.72E-01
Scleroderma 4A42.Z Whole blood 9.51E-02 5.48E-02 5.17E-01
Seizure 8A60-8A6Z Whole blood 7.56E-01 1.93E-02 1.47E-01
Sensitive skin EK0Z Skin 3.46E-02 -2.20E-01 -2.24E+00
Sepsis with septic shock 1G41 Whole blood 1.91E-02 -6.70E-02 -4.32E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.54E-01 3.59E-02 1.96E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.51E-01 -3.58E-02 -2.51E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.50E-02 9.97E-02 1.66E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.12E-02 2.10E-01 2.48E+00
Skin cancer 2C30-2C3Z Skin 7.33E-01 5.88E-02 1.08E-01
Thrombocythemia 3B63 Whole blood 5.46E-01 -5.01E-03 -2.70E-02
Thrombocytopenia 3B64 Whole blood 6.06E-01 8.27E-02 5.33E-01
Thyroid cancer 2D10 Thyroid 1.68E-01 -2.35E-02 -1.42E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.25E-01 -1.18E-01 -8.72E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.24E-01 -3.80E-02 -3.17E-01
Type 2 diabetes 5A11 Liver tissue 3.49E-01 8.53E-02 4.21E-01
Ureter cancer 2C92 Urothelium 9.20E-01 2.47E-02 9.06E-02
Uterine cancer 2C78 Endometrium tissue 6.95E-03 3.97E-02 2.47E-01
Vitiligo ED63.0 Skin 5.71E-01 -3.52E-02 -3.90E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Hormonal properties of norethisterone, 7alpha-methyl-norethisterone and their derivatives. J Steroid Biochem Mol Biol. 2000 Nov 15;74(4):213-22.
2 The effect of disease associated point mutations on 5-beta-reductase (AKR1D1) enzyme function. Chem Biol Interact. 2011 May 30;191(1-3):250-4.