Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEW527E)

DME Name Prolyl 3-hydroxylase 1 (P3H1)
Synonyms Growth suppressor 1; Leprecan-1; Leucine- and proline-enriched proteoglycan 1; LEPRE1; GROS1; P3H1; PSEC0109
Gene Name P3H1
UniProt ID
P3H1_HUMAN
INTEDE ID
DME0508
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
64175
EC Number EC: 1.14.11.7
Oxidoreductase
Oxygen paired donor oxidoreductase
2-oxoglutarate donor oxidoreductase
EC: 1.14.11.7
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAVRALKLLTTLLAVVAAASQAEVESEAGWGMVTPDLLFAEGTAAYARGDWPGVVLSMER
ALRSRAALRALRLRCRTQCAADFPWELDPDWSPSPAQASGAAALRDLSFFGGLLRRAACL
RRCLGPPAAHSLSEEMELEFRKRSPYNYLQVAYFKINKLEKAVAAAHTFFVGNPEHMEMQ
QNLDYYQTMSGVKEADFKDLETQPHMQEFRLGVRLYSEEQPQEAVPHLEAALQEYFVAYE
ECRALCEGPYDYDGYNYLEYNADLFQAITDHYIQVLNCKQNCVTELASHPSREKPFEDFL
PSHYNYLQFAYYNIGNYTQAVECAKTYLLFFPNDEVMNQNLAYYAAMLGEEHTRSIGPRE
SAKEYRQRSLLEKELLFFAYDVFGIPFVDPDSWTPEEVIPKRLQEKQKSERETAVRISQE
IGNLMKEIETLVEEKTKESLDVSRLTREGGPLLYEGISLTMNSKLLNGSQRVVMDGVISD
HECQELQRLTNVAATSGDGYRGQTSPHTPNEKFYGVTVFKALKLGQEGKVPLQSAHLYYN
VTEKVRRIMESYFRLDTPLYFSYSHLVCRTAIEEVQAERKDDSHPVHVDNCILNAETLVC
VKEPPAYTFRDYSAILYLNGDFDGGNFYFTELDAKTVTAEVQPQCGRAVGFSSGTENPHG
VKAVTRGQRCAIALWFTLDPRHSERDRVQADDLVKMLFSPEEMDLSQEQPLDAQQGPPEP
AQESLSGSESKPKDEL
Function This enzyme has prolyl 3-hydroxylase activity catalyzing the post-translational formation of 3-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens.
Reactome Pathway
Collagen biosynthesis and modifying enzymes (R-HSA-1650814 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
alpha-ketoglutaric acid DM5LFYN Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
alpha-ketoglutaric acid Discovery agent [N.A.] Investigative Km = 0.08 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.25E-20 4.85E-01 1.15E+00
Alopecia ED70 Skin from scalp 2.73E-01 -9.41E-02 -2.27E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.39E-07 1.69E-01 7.21E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.39E-01 1.63E-01 8.58E-01
Aortic stenosis BB70 Calcified aortic valve 6.38E-02 3.56E-01 1.38E+00
Apnea 7A40 Hyperplastic tonsil 6.58E-01 -3.90E-02 -1.74E-01
Arthropathy FA00-FA5Z Peripheral blood 1.10E-01 -3.07E-02 -2.58E-01
Asthma CA23 Nasal and bronchial airway 4.98E-03 1.57E-01 1.78E-01
Atopic dermatitis EA80 Skin 4.12E-04 3.95E-01 1.43E+00
Autism 6A02 Whole blood 6.86E-01 1.79E-02 7.70E-02
Autoimmune uveitis 9A96 Peripheral monocyte 7.72E-01 -1.10E-01 -6.18E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.67E-01 -5.42E-02 -1.66E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.64E-16 4.56E-01 1.40E+00
Batten disease 5C56.1 Whole blood 2.11E-01 1.97E-01 1.02E+00
Behcet's disease 4A62 Peripheral blood 4.41E-01 -7.70E-02 -5.31E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.33E-01 5.12E-02 2.28E-01
Bladder cancer 2C94 Bladder tissue 2.22E-05 5.28E-01 2.24E+00
Breast cancer 2C60-2C6Z Breast tissue 2.32E-33 3.73E-01 8.87E-01
Cardioembolic stroke 8B11.20 Whole blood 6.49E-09 -4.19E-01 -2.09E+00
Cervical cancer 2C77 Cervical tissue 1.85E-02 2.89E-01 8.16E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.42E-01 -7.34E-02 -2.21E-01
Chronic hepatitis C 1E51.1 Whole blood 1.85E-01 -1.10E-01 -4.96E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.22E-01 -5.91E-02 -1.84E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.93E-04 1.55E-01 5.44E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.08E-01 2.14E-01 4.67E-01
Colon cancer 2B90 Colon tissue 1.25E-75 8.11E-01 2.35E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.79E-01 6.34E-02 2.14E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.72E-01 1.38E-01 3.91E-01
Endometriosis GA10 Endometrium tissue 3.75E-01 -5.61E-01 -9.15E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.50E-01 1.95E-01 1.38E+00
Familial hypercholesterolemia 5C80.00 Whole blood 1.37E-15 9.34E-01 2.32E+00
Gastric cancer 2B72 Gastric tissue 2.31E-01 6.44E-01 1.17E+00
Glioblastopma 2A00.00 Nervous tissue 3.89E-72 5.20E-01 1.28E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.95E-01 1.87E-01 3.23E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.92E-03 1.97E-01 6.09E-01
Head and neck cancer 2D42 Head and neck tissue 8.26E-54 1.07E+00 4.53E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.93E-01 2.90E-02 1.63E-01
Huntington's disease 8A01.10 Whole blood 7.46E-01 2.81E-02 7.77E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.37E-02 3.60E-01 1.76E+00
Immunodeficiency 4A00-4A20 Peripheral blood 5.43E-02 -9.57E-02 -8.39E-01
Influenza 1E30 Whole blood 2.23E-04 -4.90E-01 -6.40E+00
Interstitial cystitis GC00.3 Bladder tissue 4.77E-03 6.98E-01 2.27E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.47E-06 1.06E+00 2.69E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.29E-01 -5.14E-02 -1.43E-01
Ischemic stroke 8B11 Peripheral blood 3.37E-01 4.38E-03 1.49E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.21E-05 -3.54E-01 -8.53E-01
Lateral sclerosis 8B60.4 Skin 1.17E-01 -2.52E-01 -1.00E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 1.65E-01 -2.22E-01 -5.88E-01
Liver cancer 2C12.0 Liver tissue 2.30E-11 3.96E-01 1.16E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.44E-02 5.50E-01 1.09E+00
Lung cancer 2C25 Lung tissue 1.32E-42 5.22E-01 1.46E+00
Lupus erythematosus 4A40 Whole blood 7.58E-01 3.90E-02 8.36E-02
Major depressive disorder 6A70-6A7Z Hippocampus 7.03E-01 2.18E-02 9.97E-02
Major depressive disorder 6A70-6A7Z Whole blood 5.39E-01 -4.44E-03 -1.47E-02
Melanoma 2C30 Skin 2.59E-02 8.25E-01 7.59E-01
Multiple myeloma 2A83.1 Peripheral blood 9.29E-01 -4.13E-02 -1.32E-01
Multiple myeloma 2A83.1 Bone marrow 3.57E-04 2.91E-01 2.20E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.15E-01 4.88E-02 1.87E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.53E-02 1.39E-01 3.56E-01
Myelofibrosis 2A20.2 Whole blood 8.64E-01 2.89E-03 1.93E-02
Myocardial infarction BA41-BA50 Peripheral blood 6.41E-01 1.64E-02 4.53E-02
Myopathy 8C70.6 Muscle tissue 1.73E-02 1.60E-01 7.08E-01
Neonatal sepsis KA60 Whole blood 1.96E-06 2.33E-01 7.33E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.18E-06 4.98E-01 1.89E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.10E-02 -3.10E-01 -1.92E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.89E-01 -4.22E-02 -2.20E-01
Olive pollen allergy CA08.00 Peripheral blood 2.62E-01 -1.81E-01 -7.98E-01
Oral cancer 2B6E Oral tissue 7.50E-10 6.91E-01 1.79E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.97E-01 7.64E-01 4.85E-01
Osteoporosis FB83.1 Bone marrow 9.41E-01 -9.73E-02 -2.75E-01
Ovarian cancer 2C73 Ovarian tissue 8.53E-01 1.47E-01 2.10E-01
Pancreatic cancer 2C10 Pancreas 1.89E-07 8.36E-01 2.09E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.72E-01 -1.08E-02 -5.04E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.87E-01 8.24E-02 5.06E-01
Pituitary cancer 2D12 Pituitary tissue 4.71E-06 -8.39E-01 -2.27E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.56E-08 -1.08E+00 -3.64E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.62E-01 4.10E-03 2.17E-02
Polycythemia vera 2A20.4 Whole blood 1.40E-02 -7.46E-02 -4.79E-01
Pompe disease 5C51.3 Biceps muscle 2.06E-02 4.28E-01 1.72E+00
Preterm birth KA21.4Z Myometrium 6.20E-01 -6.48E-01 -2.62E+00
Prostate cancer 2C82 Prostate 1.15E-05 -7.24E-01 -1.41E+00
Psoriasis EA90 Skin 6.58E-19 -5.38E-01 -9.56E-01
Rectal cancer 2B92 Rectal colon tissue 1.26E-03 7.82E-01 2.42E+00
Renal cancer 2C90-2C91 Kidney 2.41E-02 4.49E-01 8.29E-01
Retinoblastoma 2D02.2 Uvea 7.74E-04 7.83E-01 6.42E+00
Rheumatoid arthritis FA20 Synovial tissue 8.39E-05 1.22E+00 2.72E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.22E-01 8.02E-03 4.93E-02
Schizophrenia 6A20 Prefrontal cortex 6.51E-02 1.69E-01 2.32E-01
Schizophrenia 6A20 Superior temporal cortex 5.68E-01 6.60E-03 4.52E-02
Scleroderma 4A42.Z Whole blood 4.88E-04 -2.01E-01 -2.14E+00
Seizure 8A60-8A6Z Whole blood 4.09E-01 1.01E-01 3.19E-01
Sensitive skin EK0Z Skin 3.63E-01 7.64E-02 5.31E-01
Sepsis with septic shock 1G41 Whole blood 1.14E-01 -1.48E-02 -4.67E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.29E-04 -5.91E-01 -3.58E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.47E-01 -8.85E-03 -4.33E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 5.77E-01 1.69E-01 4.54E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.30E-02 1.04E-01 2.83E+00
Skin cancer 2C30-2C3Z Skin 1.87E-07 5.11E-01 8.32E-01
Thrombocythemia 3B63 Whole blood 4.78E-01 -5.95E-02 -3.97E-01
Thrombocytopenia 3B64 Whole blood 5.48E-01 6.19E-01 6.14E-01
Thyroid cancer 2D10 Thyroid 2.86E-25 4.05E-01 1.55E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.98E-09 9.48E-01 3.26E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.81E-01 1.42E-01 2.82E+00
Type 2 diabetes 5A11 Liver tissue 2.44E-01 -1.85E-01 -7.95E-01
Ureter cancer 2C92 Urothelium 4.94E-02 9.35E-02 7.06E-01
Uterine cancer 2C78 Endometrium tissue 7.21E-22 -1.16E+00 -1.36E+00
Vitiligo ED63.0 Skin 6.59E-01 6.10E-03 1.39E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Characterization of recombinant human prolyl 3-hydroxylase isoenzyme 2, an enzyme modifying the basement membrane collagen IV. J Biol Chem. 2008 Jul 11;283(28):19432-9.