General Information of Drug-Metabolizing Enzyme (DME) (ID: DEW8QEH)

DME Name Transglutaminase X (TGM5)
Synonyms Protein-glutamine gamma-glutamyltransferase X; Transglutaminase-5; Protein-glutamine gamma-glutamyltransferase 5; TGase X; TGase-5; TG(X); TGM5; TGMX; TGX
Gene Name TGM5
UniProt ID
TGM5_HUMAN
INTEDE ID
DME0163
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
9333
EC Number EC: 2.3.2.13
Transferase
Acyltransferase
Aminoacyltransferase
EC: 2.3.2.13
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAQGLEVALTDLQSSRNNVRHHTEEITVDHLLVRRGQAFNLTLYFRNRSFQPGLDNIIFV
VETGPLPDLALGTRAVFSLARHHSPSPWIAWLETNGATSTEVSLCAPPTAAVGRYLLKIH
IDSFQGSVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGSKNWIRPCP
WNYGQFEDKIIDICLKLLDKSLHFQTDPATDCALRGSPVYVSRVVCAMINSNDDNGVLNG
NWSENYTDGANPAEWTGSVAILKQWNATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILGNKKKDTIWNFHVWNECWMARKDLPPAYGGWQVLD
ATPQEMSNGVYCCGPASVRAIKEGEVDLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQDT
SSVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKARSFHGSQRGAELQP
SRPTSLSQDSPRSLHTPSLRPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKDLK
VNLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALG
EEKSSPEKILVNKIITLSYPSITINVLGAAVVNQPLSIQVIFSNPLSEQVEDCVLTVEGS
GLFKKQQKVFLGVLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Function This enzyme catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins.
Reactome Pathway
Formation of the cornified envelope (R-HSA-6809371 )

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.92E-09 1.12E-01 5.10E-01
Alopecia ED70 Skin from scalp 2.15E-02 1.89E-01 5.34E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.53E-01 -2.16E-02 -1.18E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.70E-01 -4.70E-02 -3.43E-01
Aortic stenosis BB70 Calcified aortic valve 7.25E-01 2.29E-01 2.67E-01
Apnea 7A40 Hyperplastic tonsil 6.55E-02 -9.87E-01 -1.62E+00
Arthropathy FA00-FA5Z Peripheral blood 4.51E-01 -7.75E-02 -3.70E-01
Asthma CA23 Nasal and bronchial airway 8.31E-03 1.94E-01 2.89E-01
Atopic dermatitis EA80 Skin 1.74E-02 -2.20E-01 -9.27E-01
Autism 6A02 Whole blood 7.47E-01 1.48E-02 6.20E-02
Autoimmune uveitis 9A96 Peripheral monocyte 1.63E-01 -8.28E-02 -4.17E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.74E-01 7.53E-03 5.85E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.10E-15 -6.04E-01 -1.31E+00
Batten disease 5C56.1 Whole blood 5.72E-02 8.93E-02 7.39E-01
Behcet's disease 4A62 Peripheral blood 7.35E-01 8.26E-02 4.16E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.14E-01 2.06E-02 7.55E-02
Bladder cancer 2C94 Bladder tissue 1.08E-03 7.30E-01 2.37E+00
Breast cancer 2C60-2C6Z Breast tissue 6.83E-28 -2.99E-01 -9.79E-01
Cardioembolic stroke 8B11.20 Whole blood 5.37E-04 2.09E-01 1.07E+00
Cervical cancer 2C77 Cervical tissue 8.59E-03 -5.74E-01 -9.63E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.48E-01 5.64E-02 1.95E-01
Chronic hepatitis C 1E51.1 Whole blood 8.26E-01 -5.22E-02 -2.77E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.09E-01 1.22E-01 4.34E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.93E-02 8.58E-02 2.92E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.88E-01 5.54E-02 3.32E-01
Colon cancer 2B90 Colon tissue 5.17E-13 -2.93E-01 -9.31E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.96E-01 -2.53E-01 -1.39E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.67E-01 -1.81E-01 -5.98E-01
Endometriosis GA10 Endometrium tissue 9.93E-02 1.22E-01 2.74E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.40E-01 -1.11E-01 -4.81E-01
Familial hypercholesterolemia 5C80.00 Whole blood 9.19E-01 6.53E-02 2.49E-01
Gastric cancer 2B72 Gastric tissue 2.17E-01 -3.00E-01 -1.29E+00
Glioblastopma 2A00.00 Nervous tissue 5.60E-01 -6.54E-02 -1.82E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.89E-01 7.14E-02 3.84E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.98E-03 -3.13E-01 -1.37E+00
Head and neck cancer 2D42 Head and neck tissue 7.12E-01 -2.42E-01 -2.42E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.22E-02 -1.62E-01 -6.33E-01
Huntington's disease 8A01.10 Whole blood 7.71E-01 -5.85E-02 -4.87E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.79E-01 1.24E-02 5.66E-02
Immunodeficiency 4A00-4A20 Peripheral blood 7.80E-01 -2.26E-02 -2.39E-01
Influenza 1E30 Whole blood 9.72E-02 2.24E-01 1.03E+00
Interstitial cystitis GC00.3 Bladder tissue 7.48E-02 -1.74E-01 -2.74E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.63E-01 2.69E-01 8.13E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.86E-02 2.82E-02 1.85E-01
Ischemic stroke 8B11 Peripheral blood 6.50E-01 3.01E-03 1.73E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.21E-02 2.16E-02 8.90E-02
Lateral sclerosis 8B60.4 Skin 1.99E-01 1.02E-01 6.32E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.39E-01 -1.72E-02 -1.18E-01
Liver cancer 2C12.0 Liver tissue 1.86E-05 -3.87E-01 -1.08E+00
Liver failure DB99.7-DB99.8 Liver tissue 9.19E-02 1.65E-01 4.06E-01
Lung cancer 2C25 Lung tissue 5.92E-03 1.86E-02 6.80E-02
Lupus erythematosus 4A40 Whole blood 1.34E-02 -3.06E-01 -3.41E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.49E-01 6.71E-02 2.57E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.48E-01 3.37E-03 1.62E-02
Melanoma 2C30 Skin 2.01E-04 -1.31E+00 -9.88E-01
Multiple myeloma 2A83.1 Peripheral blood 9.77E-01 5.99E-04 1.33E-03
Multiple myeloma 2A83.1 Bone marrow 9.67E-03 -3.85E-01 -1.13E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.71E-01 -1.63E-01 -8.35E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.42E-01 3.85E-02 1.39E-01
Myelofibrosis 2A20.2 Whole blood 7.70E-01 6.42E-03 4.65E-02
Myocardial infarction BA41-BA50 Peripheral blood 1.85E-01 1.46E-01 1.25E-01
Myopathy 8C70.6 Muscle tissue 4.64E-02 -2.01E-01 -8.40E-01
Neonatal sepsis KA60 Whole blood 3.05E-04 2.00E-01 6.41E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.16E-05 -1.01E+00 -2.71E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.12E-01 -4.48E-02 -2.16E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.18E-01 1.34E-01 9.22E-01
Olive pollen allergy CA08.00 Peripheral blood 1.59E-01 3.73E-01 9.86E-01
Oral cancer 2B6E Oral tissue 1.95E-06 -9.62E-01 -1.20E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.13E-01 -3.20E-01 -9.40E-01
Osteoporosis FB83.1 Bone marrow 2.84E-01 1.02E-01 4.46E-01
Ovarian cancer 2C73 Ovarian tissue 4.43E-01 -1.11E-01 -6.93E-01
Pancreatic cancer 2C10 Pancreas 9.32E-02 -2.35E-01 -4.83E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.28E-01 -5.97E-02 -1.68E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.93E-01 8.36E-03 5.14E-02
Pituitary cancer 2D12 Pituitary tissue 2.53E-01 0.00E+00 0.00E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.17E-01 -5.01E-02 -1.48E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.55E-02 -2.67E-02 -2.26E-01
Polycythemia vera 2A20.4 Whole blood 1.46E-01 1.07E-02 6.29E-02
Pompe disease 5C51.3 Biceps muscle 3.33E-03 -2.00E-01 -1.81E+00
Preterm birth KA21.4Z Myometrium 9.06E-01 -6.34E-02 -3.44E-01
Prostate cancer 2C82 Prostate 2.03E-05 -2.13E+00 -1.80E+00
Psoriasis EA90 Skin 1.44E-05 3.04E-01 5.99E-01
Rectal cancer 2B92 Rectal colon tissue 8.09E-01 -2.54E-02 -6.44E-02
Renal cancer 2C90-2C91 Kidney 1.50E-02 -4.18E-01 -1.21E+00
Retinoblastoma 2D02.2 Uvea 2.59E-03 -4.82E-01 -4.14E+00
Rheumatoid arthritis FA20 Synovial tissue 1.13E-01 -1.08E-01 -3.34E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.45E-01 -3.37E-02 -1.84E-01
Schizophrenia 6A20 Prefrontal cortex 1.62E-01 4.40E-02 1.09E-01
Schizophrenia 6A20 Superior temporal cortex 1.09E-01 -8.45E-02 -5.57E-01
Scleroderma 4A42.Z Whole blood 8.42E-01 2.23E-02 7.64E-02
Seizure 8A60-8A6Z Whole blood 4.00E-01 -1.04E-01 -5.16E-01
Sensitive skin EK0Z Skin 6.23E-01 3.90E-02 1.37E-01
Sepsis with septic shock 1G41 Whole blood 2.22E-07 2.22E-01 6.35E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.87E-02 1.98E-01 7.92E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.90E-01 3.53E-01 8.27E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.84E-01 2.15E-02 1.40E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.16E-01 -6.57E-02 -1.67E-01
Skin cancer 2C30-2C3Z Skin 8.04E-78 -1.82E+00 -3.33E+00
Thrombocythemia 3B63 Whole blood 1.69E-01 3.61E-02 2.63E-01
Thrombocytopenia 3B64 Whole blood 6.65E-01 1.79E-01 9.21E-01
Thyroid cancer 2D10 Thyroid 3.36E-04 1.14E-01 3.34E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.27E-01 -1.05E-01 -3.79E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.60E-03 4.74E-01 5.60E+00
Type 2 diabetes 5A11 Liver tissue 6.59E-01 1.90E-02 1.26E-01
Ureter cancer 2C92 Urothelium 7.87E-01 6.07E-02 1.74E-01
Uterine cancer 2C78 Endometrium tissue 3.92E-01 1.26E-01 1.91E-01
Vitiligo ED63.0 Skin 2.46E-02 2.86E-01 1.35E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases