Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEX8J7E)

DME Name Testicular 17-beta-hydroxysteroid dehydrogenase (HSD17B3)
Synonyms Testosterone 17-beta-dehydrogenase 3; 17-beta-HSD 3; 17-beta-hydroxysteroid dehydrogenase type 3; Short chain dehydrogenase/reductase family 12C member 2; EDH17B3; HSD17B3; SDR12C2
Gene Name HSD17B3
UniProt ID
DHB3_HUMAN
INTEDE ID
DME0423
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3293
EC Number EC: 1.1.1.64
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.64
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGI
GKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKL
AGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLI
LNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLN
TNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYV
AYLKLNTKVR
Function This enzyme favors the reduction of androstenedione to testosterone.
KEGG Pathway
Metabolic pathways (hsa01100 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Synthesis of very long-chain fatty acyl-CoAs (R-HSA-75876 )
Androgen biosynthesis (R-HSA-193048 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
4-ANDROSTENE-3-17-DIONE DMSE8NU Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.84E-01 -2.75E-02 -1.14E-01
Alopecia ED70 Skin from scalp 8.50E-01 8.33E-02 2.14E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.31E-02 3.27E-01 4.98E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.61E-01 5.36E-02 3.25E-01
Aortic stenosis BB70 Calcified aortic valve 5.18E-01 -5.72E-02 -8.88E-02
Apnea 7A40 Hyperplastic tonsil 2.46E-01 -1.71E-01 -3.08E-01
Arthropathy FA00-FA5Z Peripheral blood 1.66E-01 9.80E-02 4.40E-01
Asthma CA23 Nasal and bronchial airway 2.17E-05 3.69E-01 3.38E-01
Atopic dermatitis EA80 Skin 4.53E-01 -4.40E-02 -3.42E-01
Autism 6A02 Whole blood 5.72E-01 -3.64E-02 -1.35E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.66E-05 -3.13E-01 -2.24E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.77E-01 1.27E-01 8.41E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.40E-03 1.37E-01 4.27E-01
Batten disease 5C56.1 Whole blood 6.57E-01 1.03E-01 1.72E-01
Behcet's disease 4A62 Peripheral blood 5.46E-01 0.00E+00 0.00E+00
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.17E-01 -6.94E-02 -2.23E-01
Bladder cancer 2C94 Bladder tissue 5.71E-07 5.22E-01 3.14E+00
Breast cancer 2C60-2C6Z Breast tissue 7.86E-01 -1.58E-03 -5.22E-03
Cardioembolic stroke 8B11.20 Whole blood 1.71E-01 -1.74E-01 -4.48E-01
Cervical cancer 2C77 Cervical tissue 3.36E-01 -9.86E-02 -3.27E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.95E-01 -4.52E-02 -1.26E-01
Chronic hepatitis C 1E51.1 Whole blood 1.41E-01 6.76E-02 4.40E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.72E-01 9.37E-02 3.64E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.23E-02 -2.85E-01 -5.61E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.88E-01 -2.03E-01 -3.43E-01
Colon cancer 2B90 Colon tissue 7.75E-01 -8.79E-02 -3.01E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.17E-01 1.02E-03 6.51E-03
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.83E-01 -2.80E-02 -1.06E-01
Endometriosis GA10 Endometrium tissue 1.99E-01 6.70E-02 2.28E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.16E-01 -4.40E-02 -2.41E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.92E-02 -2.91E-01 -1.02E+00
Gastric cancer 2B72 Gastric tissue 5.18E-01 2.10E-01 7.47E-01
Glioblastopma 2A00.00 Nervous tissue 2.56E-02 -1.51E-01 -2.07E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.45E-01 -1.05E+00 -5.72E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.10E-03 -9.42E-01 -1.40E+00
Head and neck cancer 2D42 Head and neck tissue 1.98E-08 -3.05E-01 -3.08E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.95E-01 -6.88E-02 -9.55E-02
Huntington's disease 8A01.10 Whole blood 1.45E-01 6.61E-03 2.87E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.03E-01 -1.31E-01 -5.44E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.99E-01 7.00E-02 1.06E+00
Influenza 1E30 Whole blood 9.98E-01 1.78E-01 2.59E+00
Interstitial cystitis GC00.3 Bladder tissue 1.60E-01 1.07E-01 1.03E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.07E-03 -4.03E-01 -1.16E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.92E-01 -1.04E-01 -1.99E-01
Ischemic stroke 8B11 Peripheral blood 4.28E-02 1.08E-01 4.77E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.87E-01 -9.37E-02 -2.46E-01
Lateral sclerosis 8B60.4 Skin 6.15E-01 4.98E-02 3.91E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.29E-01 -1.80E-01 -3.68E-01
Liver cancer 2C12.0 Liver tissue 6.85E-02 9.78E-02 2.07E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.40E-04 -6.87E-01 -2.32E+00
Lung cancer 2C25 Lung tissue 5.91E-08 -5.47E-03 -2.32E-02
Lupus erythematosus 4A40 Whole blood 1.15E-01 -6.12E-02 -1.33E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.11E-01 1.69E-02 5.33E-02
Major depressive disorder 6A70-6A7Z Whole blood 3.68E-01 1.35E-02 3.95E-02
Melanoma 2C30 Skin 4.96E-01 1.75E-02 2.34E-02
Multiple myeloma 2A83.1 Peripheral blood 4.51E-01 1.18E-02 5.62E-02
Multiple myeloma 2A83.1 Bone marrow 6.13E-01 -1.66E-01 -8.01E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.46E-01 4.07E-01 1.16E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.05E-01 1.82E-03 9.37E-03
Myelofibrosis 2A20.2 Whole blood 4.79E-01 -8.25E-02 -5.41E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.77E-01 -3.71E-02 -5.93E-02
Myopathy 8C70.6 Muscle tissue 8.43E-01 -4.30E-02 -2.54E-01
Neonatal sepsis KA60 Whole blood 3.77E-01 -3.78E-02 -1.36E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.47E-05 -1.12E+00 -2.98E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.77E-01 1.38E-01 6.24E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.31E-02 1.13E-01 1.01E+00
Olive pollen allergy CA08.00 Peripheral blood 4.75E-01 -1.56E-01 -4.42E-01
Oral cancer 2B6E Oral tissue 4.83E-01 3.87E-02 8.34E-02
Osteoarthritis FA00-FA0Z Synovial tissue 5.78E-01 -2.52E-03 -1.38E-02
Osteoporosis FB83.1 Bone marrow 4.58E-03 3.60E-01 2.08E+00
Ovarian cancer 2C73 Ovarian tissue 7.75E-02 -5.63E-02 -1.82E-01
Pancreatic cancer 2C10 Pancreas 4.28E-01 -1.09E-01 -1.83E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.21E-01 -2.64E-01 -6.16E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.38E-01 5.59E-02 3.25E-01
Pituitary cancer 2D12 Pituitary tissue 4.77E-03 -2.04E-01 -5.71E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.78E-02 -2.01E-01 -5.36E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.22E-01 1.09E-01 5.00E-01
Polycythemia vera 2A20.4 Whole blood 1.30E-01 -6.51E-02 -4.20E-01
Pompe disease 5C51.3 Biceps muscle 6.99E-03 5.87E-01 1.97E+00
Preterm birth KA21.4Z Myometrium 6.25E-01 1.20E-02 1.74E-01
Prostate cancer 2C82 Prostate 3.54E-02 2.20E-01 3.98E-01
Psoriasis EA90 Skin 2.59E-01 7.23E-03 2.40E-02
Rectal cancer 2B92 Rectal colon tissue 8.61E-01 -1.54E-01 -3.49E-01
Renal cancer 2C90-2C91 Kidney 2.56E-02 1.33E-01 4.05E-01
Retinoblastoma 2D02.2 Uvea 2.57E-01 -7.97E-03 -2.57E-02
Rheumatoid arthritis FA20 Synovial tissue 6.10E-01 -2.01E-01 -4.53E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.61E-01 7.05E-03 2.24E-02
Schizophrenia 6A20 Prefrontal cortex 9.91E-02 -9.25E-03 -2.52E-02
Schizophrenia 6A20 Superior temporal cortex 2.18E-02 -2.09E-01 -6.15E-01
Scleroderma 4A42.Z Whole blood 3.65E-01 1.01E-01 2.63E-01
Seizure 8A60-8A6Z Whole blood 8.25E-01 5.11E-02 2.67E-01
Sensitive skin EK0Z Skin 3.31E-01 3.00E-02 1.88E-01
Sepsis with septic shock 1G41 Whole blood 3.39E-01 6.11E-03 2.15E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.42E-01 4.54E-01 1.16E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.55E-02 -1.05E+00 -9.12E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.22E-01 4.39E-02 3.71E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.72E-01 -1.31E-01 -3.58E-01
Skin cancer 2C30-2C3Z Skin 7.54E-04 8.39E-02 2.00E-01
Thrombocythemia 3B63 Whole blood 5.17E-01 5.64E-02 3.75E-01
Thrombocytopenia 3B64 Whole blood 9.76E-01 1.21E-01 3.38E-01
Thyroid cancer 2D10 Thyroid 3.13E-31 -7.92E-01 -1.96E+00
Tibial muscular dystrophy 8C75 Muscle tissue 5.51E-03 2.12E-01 1.08E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.41E-01 4.95E-01 1.14E+00
Type 2 diabetes 5A11 Liver tissue 5.79E-01 -9.78E-02 -1.66E-01
Ureter cancer 2C92 Urothelium 1.76E-01 -1.55E-01 -6.30E-01
Uterine cancer 2C78 Endometrium tissue 2.37E-03 2.63E-02 7.00E-02
Vitiligo ED63.0 Skin 2.06E-01 1.62E-01 8.47E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 17beta-hydroxysteroid dehydrogenase-3 deficiency: a rare endocrine cause of male-to-female sex reversal. Gynecol Endocrinol. 2006 Sep;22(9):488-94.