Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEXI4UQ)

DME Name Aldehyde dehydrogenase 5 (ALDHX)
Synonyms Aldehyde dehydrogenase 1 family member B1; Mitochondrial aldehyde dehydrogenase X; ALDH1B1; ALDH5; ALDHX
Gene Name ALDH1B1
UniProt ID
AL1B1_HUMAN
INTEDE ID
DME0289
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
219
EC Number EC: 1.2.1.3
Oxidoreductase
Aldehyde/oxo donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.2.1.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPT
TGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLA
SLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCG
QIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITG
YGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM
EHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGP
QVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
Function This enzyme plays a major role in the detoxification of alcohol-derived acetaldehyde and is involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation.
KEGG Pathway
Arginine and proline metabolism (hsa00330 )
Ascorbate and aldarate metabolism (hsa00053 )
Fatty acid degradation (hsa00071 )
Glycerolipid metabolism (hsa00561 )
Glycolysis / Gluconeogenesis (hsa00010 )
Histidine metabolism (hsa00340 )
Lysine degradation (hsa00310 )
Metabolic pathways (hsa01100 )
Pyruvate metabolism (hsa00620 )
Tryptophan metabolism (hsa00380 )
Valine, leucine and isoleucine degradation (hsa00280 )
beta-Alanine metabolism (hsa00410 )
Reactome Pathway
Ethanol oxidation (R-HSA-71384 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
3,4-dihydroxyphenylacetaldehyde DM7N3MX Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
3,4-dihydroxyphenylacetaldehyde Discovery agent [N.A.] Investigative Km = 0.0004 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.05E-14 1.86E-01 9.44E-01
Alopecia ED70 Skin from scalp 8.22E-01 -3.29E-02 -1.65E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.88E-05 -1.12E-01 -5.57E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.25E-01 2.07E-01 9.32E-01
Aortic stenosis BB70 Calcified aortic valve 6.06E-01 8.10E-02 1.46E-01
Apnea 7A40 Hyperplastic tonsil 5.34E-01 1.76E-02 1.14E-01
Arthropathy FA00-FA5Z Peripheral blood 5.16E-01 3.21E-02 2.79E-01
Asthma CA23 Nasal and bronchial airway 5.65E-02 -1.39E-01 -1.25E-01
Atopic dermatitis EA80 Skin 5.46E-03 -1.69E-01 -8.30E-01
Autism 6A02 Whole blood 2.73E-01 -4.36E-02 -2.09E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.64E-05 -4.73E-01 -2.22E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.49E-01 -4.43E-02 -3.32E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.59E-03 1.31E-01 5.68E-01
Batten disease 5C56.1 Whole blood 8.13E-01 -1.20E-02 -1.92E-01
Behcet's disease 4A62 Peripheral blood 7.82E-01 -3.64E-02 -1.45E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.42E-01 -5.38E-02 -3.28E-01
Bladder cancer 2C94 Bladder tissue 8.95E-01 1.39E-01 1.86E-01
Breast cancer 2C60-2C6Z Breast tissue 1.04E-23 2.60E-01 7.61E-01
Cardioembolic stroke 8B11.20 Whole blood 9.35E-01 -7.84E-03 -3.56E-02
Cervical cancer 2C77 Cervical tissue 1.58E-03 9.30E-02 4.76E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.80E-01 -1.91E-02 -1.27E-01
Chronic hepatitis C 1E51.1 Whole blood 6.40E-01 -1.04E-01 -7.41E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.11E-01 2.81E-02 9.61E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.22E-01 -2.66E-02 -1.47E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.50E-01 -8.79E-02 -1.27E+00
Colon cancer 2B90 Colon tissue 4.89E-18 3.02E-01 7.81E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.27E-01 1.26E-02 1.29E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.33E-01 5.98E-02 2.05E-01
Endometriosis GA10 Endometrium tissue 2.56E-01 6.51E-03 2.49E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.45E-01 -1.95E-02 -1.79E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.46E-03 -9.77E-02 -5.68E-01
Gastric cancer 2B72 Gastric tissue 1.61E-01 1.01E+00 1.48E+00
Glioblastopma 2A00.00 Nervous tissue 4.11E-08 8.00E-02 2.92E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.83E-01 1.19E-01 8.67E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.01E-05 -3.76E-01 -1.68E+00
Head and neck cancer 2D42 Head and neck tissue 5.34E-13 2.06E-01 1.12E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.86E-01 -7.01E-02 -4.02E-01
Huntington's disease 8A01.10 Whole blood 3.51E-01 5.01E-02 2.89E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.78E-02 1.98E-01 9.32E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.80E-01 7.31E-02 1.10E+00
Influenza 1E30 Whole blood 3.41E-02 -3.79E-01 -2.24E+00
Interstitial cystitis GC00.3 Bladder tissue 2.00E-01 4.32E-01 1.20E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.97E-05 -1.34E+00 -1.57E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.52E-01 1.46E-02 7.32E-02
Ischemic stroke 8B11 Peripheral blood 4.52E-01 -2.35E-02 -1.54E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.45E-01 -1.02E-02 -4.12E-02
Lateral sclerosis 8B60.4 Skin 6.89E-01 -2.20E-01 -3.40E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.60E-01 1.24E+00 1.59E+00
Liver cancer 2C12.0 Liver tissue 9.97E-07 -1.21E+00 -1.31E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.15E-03 -9.89E-01 -1.90E+00
Lung cancer 2C25 Lung tissue 2.23E-10 1.78E-01 5.37E-01
Lupus erythematosus 4A40 Whole blood 1.45E-01 5.63E-02 1.03E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.76E-01 -3.72E-02 -2.20E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.64E-01 1.37E-02 9.22E-02
Melanoma 2C30 Skin 2.85E-01 -4.00E-01 -5.14E-01
Multiple myeloma 2A83.1 Peripheral blood 4.38E-01 -1.60E-01 -4.90E-01
Multiple myeloma 2A83.1 Bone marrow 1.67E-01 7.91E-02 3.96E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.13E-01 3.97E-02 1.53E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.33E-03 5.40E-02 2.78E-01
Myelofibrosis 2A20.2 Whole blood 5.43E-01 -9.21E-02 -8.65E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.74E-01 -1.93E-01 -2.41E-01
Myopathy 8C70.6 Muscle tissue 6.78E-04 6.79E-01 1.62E+00
Neonatal sepsis KA60 Whole blood 3.58E-02 -8.44E-02 -3.90E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.84E-05 4.83E-01 2.22E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.73E-02 3.20E-01 1.40E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.62E-01 -2.94E-02 -1.45E-01
Olive pollen allergy CA08.00 Peripheral blood 8.38E-01 -2.39E-02 -1.12E-01
Oral cancer 2B6E Oral tissue 1.63E-01 -5.00E-02 -1.64E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.85E-01 -1.73E-01 -3.78E-01
Osteoporosis FB83.1 Bone marrow 4.78E-01 5.78E-01 4.72E-01
Ovarian cancer 2C73 Ovarian tissue 6.94E-01 6.13E-02 1.35E-01
Pancreatic cancer 2C10 Pancreas 1.15E-03 3.20E-01 7.37E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.50E-02 -1.31E-01 -7.59E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.01E-03 -1.25E-01 -9.47E-01
Pituitary cancer 2D12 Pituitary tissue 9.90E-05 4.20E-01 1.72E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.52E-02 2.23E-01 9.17E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.77E-01 8.99E-02 4.40E-01
Polycythemia vera 2A20.4 Whole blood 1.76E-01 -5.05E-02 -4.85E-01
Pompe disease 5C51.3 Biceps muscle 2.96E-06 2.39E+00 1.00E+01
Preterm birth KA21.4Z Myometrium 2.45E-01 8.01E-01 1.25E+00
Prostate cancer 2C82 Prostate 7.00E-05 1.24E+00 1.15E+00
Psoriasis EA90 Skin 1.47E-03 1.03E-01 2.32E-01
Rectal cancer 2B92 Rectal colon tissue 1.90E-02 3.80E-01 1.54E+00
Renal cancer 2C90-2C91 Kidney 1.30E-01 -5.53E-01 -8.49E-01
Retinoblastoma 2D02.2 Uvea 4.01E-07 1.96E+00 1.53E+01
Rheumatoid arthritis FA20 Synovial tissue 5.33E-03 2.81E-01 1.17E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.96E-01 -3.31E-03 -2.52E-02
Schizophrenia 6A20 Prefrontal cortex 7.97E-01 -6.93E-03 -3.55E-02
Schizophrenia 6A20 Superior temporal cortex 6.18E-01 -1.62E-02 -1.50E-01
Scleroderma 4A42.Z Whole blood 4.97E-01 6.98E-02 4.70E-01
Seizure 8A60-8A6Z Whole blood 5.12E-01 -2.08E-03 -1.27E-02
Sensitive skin EK0Z Skin 5.98E-01 2.61E-02 8.41E-02
Sepsis with septic shock 1G41 Whole blood 7.91E-02 -2.78E-02 -1.49E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.92E-01 1.58E-01 9.08E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.90E-01 3.05E-02 1.30E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.67E-01 5.26E-03 2.89E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.89E-01 -1.51E-01 -6.68E-01
Skin cancer 2C30-2C3Z Skin 1.84E-16 5.01E-01 8.19E-01
Thrombocythemia 3B63 Whole blood 1.39E-01 -1.35E-01 -1.27E+00
Thrombocytopenia 3B64 Whole blood 8.31E-01 -1.57E-02 -6.19E-02
Thyroid cancer 2D10 Thyroid 9.12E-25 -6.05E-01 -1.68E+00
Tibial muscular dystrophy 8C75 Muscle tissue 8.40E-01 1.83E-02 4.32E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.94E-01 3.92E-02 4.35E-01
Type 2 diabetes 5A11 Liver tissue 1.89E-01 3.11E-01 1.03E+00
Ureter cancer 2C92 Urothelium 9.82E-02 4.10E-03 3.43E-02
Uterine cancer 2C78 Endometrium tissue 3.30E-01 -4.96E-02 -8.78E-02
Vitiligo ED63.0 Skin 7.65E-01 3.37E-02 1.38E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Neurotoxicity and metabolism of the catecholamine-derived 3,4-dihydroxyphenylacetaldehyde and 3,4-dihydroxyphenylglycolaldehyde: the role of aldehyde dehydrogenase. Pharmacol Rev. 2007 Jun;59(2):125-50.