General Information of Drug-Metabolizing Enzyme (DME) (ID: DEXISVQ)

DME Name Asparagine synthetase (ASNS)
Synonyms Asparagine synthetase [glutamine-hydrolyzing]; Cell cycle control protein TS11; Glutamine-dependent asparagine synthetase; ASNS; TS11
Gene Name ASNS
UniProt ID
ASNS_HUMAN
INTEDE ID
DME0154
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
440
EC Number EC: 6.3.5.4
Ligase
Carbon-nitrogen ligase
Carbon-nitrogen ligase
EC: 6.3.5.4
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGV
FAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFN
NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
KVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
WFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPK
WINATDPSARTLTHYKSAVKA
Function This enzyme is a chiefly cytoplasmic enzyme that generates asparagine from aspartate.
KEGG Pathway
Alanine, aspartate and glutamate metabolism (hsa00250 )
Biosynthesis of amino acids (hsa01230 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Aspartate and asparagine metabolism (R-HSA-8963693 )
ATF4 activates genes in response to endoplasmic reticulum stress (R-HSA-380994 )

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.30E-02 -7.99E-02 -2.59E-01
Alopecia ED70 Skin from scalp 3.02E-02 1.07E-01 4.92E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.89E-07 -1.70E-01 -7.36E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.81E-01 -5.44E-02 -1.01E-01
Aortic stenosis BB70 Calcified aortic valve 6.21E-01 -2.63E-01 -3.23E-01
Apnea 7A40 Hyperplastic tonsil 8.57E-01 -1.70E-02 -3.37E-02
Arthropathy FA00-FA5Z Peripheral blood 1.39E-01 -2.06E-01 -8.74E-01
Asthma CA23 Nasal and bronchial airway 1.05E-04 7.60E-02 2.45E-01
Atopic dermatitis EA80 Skin 2.63E-01 -1.03E-01 -8.36E-01
Autism 6A02 Whole blood 6.23E-01 2.92E-02 1.19E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.34E-01 -7.35E-03 -3.12E-02
Autosomal dominant monocytopenia 4B04 Whole blood 5.75E-01 -3.11E-02 -1.20E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.69E-07 1.48E-01 7.13E-01
Batten disease 5C56.1 Whole blood 2.56E-01 3.66E-02 2.37E-01
Behcet's disease 4A62 Peripheral blood 3.29E-02 -2.17E-01 -9.91E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.41E-02 -3.72E-02 -2.61E-01
Bladder cancer 2C94 Bladder tissue 1.23E-02 2.86E-01 1.48E+00
Breast cancer 2C60-2C6Z Breast tissue 2.67E-93 6.32E-01 1.94E+00
Cardioembolic stroke 8B11.20 Whole blood 2.07E-01 -6.78E-02 -3.73E-01
Cervical cancer 2C77 Cervical tissue 1.86E-02 7.75E-02 3.53E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.94E-01 -1.33E-01 -2.46E-01
Chronic hepatitis C 1E51.1 Whole blood 1.44E-01 -2.13E-01 -1.11E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 6.28E-01 1.34E-02 5.96E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.72E-01 1.21E-02 5.62E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.98E-01 1.07E-01 5.68E-01
Colon cancer 2B90 Colon tissue 1.79E-91 7.21E-01 2.80E+00
Coronary artery disease BA80-BA8Z Peripheral blood 9.82E-01 1.85E-01 3.87E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.88E-01 -3.08E-02 -9.25E-02
Endometriosis GA10 Endometrium tissue 6.02E-02 -1.19E-01 -2.12E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.10E-01 8.06E-02 6.51E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.56E-08 -6.80E-01 -1.82E+00
Gastric cancer 2B72 Gastric tissue 9.90E-01 -5.81E-02 -1.12E-01
Glioblastopma 2A00.00 Nervous tissue 1.15E-22 -3.14E-01 -8.61E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.99E-01 -1.91E-01 -3.28E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.23E-02 4.76E-01 9.41E-01
Head and neck cancer 2D42 Head and neck tissue 5.11E-11 2.24E-01 8.88E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.86E-01 -1.73E-01 -4.02E-01
Huntington's disease 8A01.10 Whole blood 9.73E-01 -9.82E-02 -3.41E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.34E-02 -2.51E-01 -5.84E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.35E-01 3.66E-02 3.07E-01
Influenza 1E30 Whole blood 8.96E-01 -1.42E-01 -1.59E-01
Interstitial cystitis GC00.3 Bladder tissue 8.66E-04 2.60E-01 3.76E+00
Intracranial aneurysm 8B01.0 Intracranial artery 6.87E-03 -1.53E-01 -6.77E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.88E-02 6.86E-02 3.65E-01
Ischemic stroke 8B11 Peripheral blood 7.18E-01 3.52E-02 1.46E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.41E-02 1.19E-02 3.95E-02
Lateral sclerosis 8B60.4 Skin 6.72E-01 5.58E-03 1.77E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 9.17E-01 -8.44E-02 -1.12E-01
Liver cancer 2C12.0 Liver tissue 1.35E-07 5.47E-01 1.03E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.35E-06 1.13E+00 3.44E+00
Lung cancer 2C25 Lung tissue 9.92E-103 5.70E-01 2.53E+00
Lupus erythematosus 4A40 Whole blood 5.78E-01 -2.35E-03 -6.41E-03
Major depressive disorder 6A70-6A7Z Hippocampus 4.18E-01 3.06E-02 2.27E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.53E-01 -1.65E-02 -9.05E-02
Melanoma 2C30 Skin 8.74E-03 -3.80E-01 -5.91E-01
Multiple myeloma 2A83.1 Peripheral blood 7.21E-01 1.33E-01 4.50E-01
Multiple myeloma 2A83.1 Bone marrow 1.40E-08 1.03E+00 7.64E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.48E-01 8.05E-02 1.29E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.31E-06 2.37E-01 1.21E+00
Myelofibrosis 2A20.2 Whole blood 8.51E-02 3.44E-01 2.51E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.80E-01 -2.38E-01 -3.77E-01
Myopathy 8C70.6 Muscle tissue 1.05E-03 6.11E-01 1.55E+00
Neonatal sepsis KA60 Whole blood 6.92E-03 -1.86E-01 -5.25E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.42E-06 8.64E-01 2.92E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.34E-01 -8.57E-02 -3.65E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.78E-02 -2.77E-01 -1.13E+00
Olive pollen allergy CA08.00 Peripheral blood 1.22E-01 -4.54E-01 -7.62E-01
Oral cancer 2B6E Oral tissue 2.02E-02 2.81E-01 6.48E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.84E-01 -1.49E-02 -1.38E-02
Osteoporosis FB83.1 Bone marrow 4.84E-03 8.49E-01 3.27E+00
Ovarian cancer 2C73 Ovarian tissue 2.15E-02 3.81E-01 8.75E-01
Pancreatic cancer 2C10 Pancreas 4.16E-03 -3.50E-01 -1.00E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 3.90E-01 4.59E-02 1.02E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.92E-02 -1.36E-01 -9.12E-01
Pituitary cancer 2D12 Pituitary tissue 7.05E-01 -6.62E-02 -4.09E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.47E-03 -2.34E-01 -1.83E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.44E-01 -4.48E-02 -2.99E-01
Polycythemia vera 2A20.4 Whole blood 2.25E-07 -1.81E-01 -1.32E+00
Pompe disease 5C51.3 Biceps muscle 1.90E-02 4.57E-01 1.10E+00
Preterm birth KA21.4Z Myometrium 2.82E-01 -1.83E-01 -4.84E-01
Prostate cancer 2C82 Prostate 1.04E-07 3.78E-01 1.28E+00
Psoriasis EA90 Skin 4.06E-19 2.46E-01 1.42E+00
Rectal cancer 2B92 Rectal colon tissue 3.12E-03 3.95E-01 1.90E+00
Renal cancer 2C90-2C91 Kidney 3.93E-05 7.68E-01 2.11E+00
Retinoblastoma 2D02.2 Uvea 8.00E-05 -8.29E-01 -3.55E+00
Rheumatoid arthritis FA20 Synovial tissue 1.49E-01 7.25E-02 1.42E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.71E-01 -3.45E-02 -2.19E-01
Schizophrenia 6A20 Prefrontal cortex 1.44E-02 -2.12E-01 -4.15E-01
Schizophrenia 6A20 Superior temporal cortex 7.68E-01 -9.27E-02 -3.51E-01
Scleroderma 4A42.Z Whole blood 5.92E-01 -3.34E-02 -2.47E-01
Seizure 8A60-8A6Z Whole blood 8.97E-01 -3.21E-02 -7.44E-02
Sensitive skin EK0Z Skin 8.30E-01 4.61E-02 6.44E-01
Sepsis with septic shock 1G41 Whole blood 7.41E-05 -1.87E-01 -5.66E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.75E-01 -1.07E-01 -3.67E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.27E-02 -4.18E-01 -8.49E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.64E-02 8.05E-02 1.49E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.67E-01 -2.70E-01 -9.99E-01
Skin cancer 2C30-2C3Z Skin 3.99E-03 1.21E-01 4.96E-01
Thrombocythemia 3B63 Whole blood 6.58E-03 -1.49E-01 -1.12E+00
Thrombocytopenia 3B64 Whole blood 1.77E-01 1.17E-01 5.37E-01
Thyroid cancer 2D10 Thyroid 3.07E-02 2.51E-02 1.24E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.17E-04 3.21E-01 1.45E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.29E-02 -3.32E-01 -3.54E+00
Type 2 diabetes 5A11 Liver tissue 7.74E-01 -1.21E-02 -3.61E-02
Ureter cancer 2C92 Urothelium 1.51E-02 6.22E-02 8.13E-01
Uterine cancer 2C78 Endometrium tissue 1.77E-17 3.27E-01 9.37E-01
Vitiligo ED63.0 Skin 1.30E-01 1.73E-01 1.09E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases