General Information of Drug-Metabolizing Enzyme (DME) (ID: DEXKD7J)

DME Name Carboxypeptidase A4 (CPA4)
Synonyms Carboxypeptidase A/B subfamily member 4; Carboxypeptidase A3; CPA3; CPA4; UNQ694/PRO1339
Gene Name CPA4
UniProt ID
CBPA4_HUMAN
INTEDE ID
DME0593
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
51200
EC Number EC: 3.4.17.1
Hydrolases
Peptidase
Metallocarboxypeptidase
EC: 3.4.17.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MRWILFIGALIGSSICGQEKFFGDQVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSF
NRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNY
GAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGI
HSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRK
TRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGN
FKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVY
PASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNL
Y
Function This enzyme can be involved in the histone hyperacetylation pathway. It releases a C-terminal amino acid, with preference for -Phe, -Leu, -Ile, -Met, -Tyr and -Val.

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Preclinical Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
ET-1 DMA85ND N. A. N. A. Phase 0 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.29E-01 -2.62E-02 -8.57E-02
Alopecia ED70 Skin from scalp 8.33E-09 -3.04E-01 -1.69E+00
Alzheimer's disease 8A20 Entorhinal cortex 2.89E-01 -3.24E-02 -1.60E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.19E-01 -8.69E-02 -1.13E+00
Aortic stenosis BB70 Calcified aortic valve 9.21E-01 8.84E-02 1.09E-01
Apnea 7A40 Hyperplastic tonsil 2.42E-01 -3.18E-01 -1.16E+00
Arthropathy FA00-FA5Z Peripheral blood 5.37E-01 4.37E-02 2.64E-01
Asthma CA23 Nasal and bronchial airway 4.66E-09 1.24E+00 6.91E-01
Atopic dermatitis EA80 Skin 2.08E-02 -3.74E-01 -1.20E+00
Autism 6A02 Whole blood 2.31E-01 -1.40E-01 -5.54E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.11E-01 -4.53E-02 -1.49E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.17E-02 1.43E-01 1.00E+00
Bacterial infection of gingival 1C1H Gingival tissue 7.45E-10 -4.05E-01 -7.82E-01
Batten disease 5C56.1 Whole blood 1.93E-01 5.35E-02 4.59E-01
Behcet's disease 4A62 Peripheral blood 5.96E-01 -2.56E-02 -1.37E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.57E-01 -3.06E-02 -1.34E-01
Bladder cancer 2C94 Bladder tissue 4.69E-07 1.05E+00 4.94E+00
Breast cancer 2C60-2C6Z Breast tissue 1.33E-02 -1.09E-01 -2.12E-01
Cardioembolic stroke 8B11.20 Whole blood 2.17E-01 5.53E-02 2.72E-01
Cervical cancer 2C77 Cervical tissue 1.74E-02 -6.43E-01 -6.49E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.85E-01 7.63E-02 3.05E-01
Chronic hepatitis C 1E51.1 Whole blood 2.02E-01 2.11E-01 6.53E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.05E-02 2.45E-01 7.21E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.31E-01 4.93E-02 1.22E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.92E-02 2.92E-01 1.53E+00
Colon cancer 2B90 Colon tissue 4.26E-01 -6.06E-02 -1.83E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.27E-01 -2.96E-01 -1.39E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.14E-01 6.81E-02 2.36E-01
Endometriosis GA10 Endometrium tissue 3.03E-01 5.55E-02 1.30E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.05E-01 -2.31E-01 -7.71E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.16E-04 -5.34E-01 -1.32E+00
Gastric cancer 2B72 Gastric tissue 1.94E-01 -6.78E-01 -1.59E+00
Glioblastopma 2A00.00 Nervous tissue 5.92E-01 -1.47E-02 -2.68E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.95E-01 -6.91E-02 -2.00E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.95E-01 -4.49E-02 -1.16E-01
Head and neck cancer 2D42 Head and neck tissue 9.24E-10 7.80E-01 8.96E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.45E-01 -2.48E-02 -9.07E-02
Huntington's disease 8A01.10 Whole blood 5.58E-01 6.03E-02 2.78E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.82E-01 1.73E-01 6.94E-01
Immunodeficiency 4A00-4A20 Peripheral blood 6.48E-01 7.84E-03 1.24E-01
Influenza 1E30 Whole blood 5.32E-01 4.54E-02 1.84E-01
Interstitial cystitis GC00.3 Bladder tissue 5.50E-02 9.53E-02 7.80E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.27E-03 4.16E-01 1.61E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.81E-02 2.81E-01 6.11E-01
Ischemic stroke 8B11 Peripheral blood 1.98E-01 5.55E-02 2.83E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.85E-01 -3.70E-04 -1.51E-03
Lateral sclerosis 8B60.4 Skin 4.48E-02 4.28E-01 1.57E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 2.77E-01 9.70E-02 4.50E-01
Liver cancer 2C12.0 Liver tissue 1.48E-04 -1.99E-01 -6.97E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.59E-01 3.91E-02 1.89E-01
Lung cancer 2C25 Lung tissue 5.79E-02 1.91E-02 6.23E-02
Lupus erythematosus 4A40 Whole blood 5.92E-02 -2.72E-01 -2.31E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.22E-01 6.48E-02 2.84E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.49E-01 -1.40E-02 -6.03E-02
Melanoma 2C30 Skin 3.36E-06 -1.14E+00 -1.29E+00
Multiple myeloma 2A83.1 Peripheral blood 6.58E-02 1.26E-01 7.18E-01
Multiple myeloma 2A83.1 Bone marrow 2.76E-06 -8.10E-01 -4.79E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.63E-01 1.02E-01 3.31E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.07E-01 -3.70E-02 -1.42E-01
Myelofibrosis 2A20.2 Whole blood 2.89E-04 2.58E-01 1.71E+00
Myocardial infarction BA41-BA50 Peripheral blood 5.78E-01 1.24E-01 9.51E-02
Myopathy 8C70.6 Muscle tissue 5.00E-01 -6.21E-02 -3.01E-01
Neonatal sepsis KA60 Whole blood 3.63E-02 -1.57E-01 -4.93E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.03E-05 -1.34E+00 -2.37E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.61E-01 -1.07E-01 -6.26E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.37E-01 -2.29E-01 -4.46E-01
Olive pollen allergy CA08.00 Peripheral blood 4.18E-01 1.93E-01 7.33E-01
Oral cancer 2B6E Oral tissue 1.32E-01 1.83E-01 2.82E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.31E-01 1.98E-01 1.02E-01
Osteoporosis FB83.1 Bone marrow 5.83E-03 -1.34E+00 -2.28E+00
Ovarian cancer 2C73 Ovarian tissue 6.83E-01 -1.34E-01 -3.66E-01
Pancreatic cancer 2C10 Pancreas 5.04E-02 -3.11E-01 -5.35E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.18E-01 7.34E-02 3.80E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.12E-03 1.96E-01 1.14E+00
Pituitary cancer 2D12 Pituitary tissue 4.55E-01 1.50E-01 3.13E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.87E-01 -6.66E-03 -2.24E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.65E-01 7.75E-03 4.56E-02
Polycythemia vera 2A20.4 Whole blood 1.29E-13 2.97E-01 1.71E+00
Pompe disease 5C51.3 Biceps muscle 7.88E-04 2.68E+00 7.00E+00
Preterm birth KA21.4Z Myometrium 8.13E-01 -6.37E-02 -3.03E-01
Prostate cancer 2C82 Prostate 9.64E-06 -1.66E+00 -1.83E+00
Psoriasis EA90 Skin 2.18E-28 7.82E-01 1.58E+00
Rectal cancer 2B92 Rectal colon tissue 6.36E-01 -1.93E-02 -8.73E-02
Renal cancer 2C90-2C91 Kidney 7.46E-02 -4.42E-01 -1.01E+00
Retinoblastoma 2D02.2 Uvea 2.83E-04 -2.81E-01 -1.99E+00
Rheumatoid arthritis FA20 Synovial tissue 1.31E-03 6.07E-01 1.92E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.25E-01 9.12E-02 1.44E-01
Schizophrenia 6A20 Prefrontal cortex 4.23E-01 5.20E-02 1.02E-01
Schizophrenia 6A20 Superior temporal cortex 8.41E-01 2.09E-02 1.01E-01
Scleroderma 4A42.Z Whole blood 1.91E-01 5.70E-02 4.74E-01
Seizure 8A60-8A6Z Whole blood 7.94E-01 7.10E-02 2.28E-01
Sensitive skin EK0Z Skin 8.32E-01 4.03E-02 1.16E-01
Sepsis with septic shock 1G41 Whole blood 2.99E-07 1.58E-01 6.01E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.76E-02 1.09E+00 2.07E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.33E-02 3.19E-01 1.13E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.50E-03 1.17E-01 5.52E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.43E-01 1.22E-02 2.88E-02
Skin cancer 2C30-2C3Z Skin 5.42E-67 -1.60E+00 -2.95E+00
Thrombocythemia 3B63 Whole blood 5.08E-09 2.78E-01 1.77E+00
Thrombocytopenia 3B64 Whole blood 3.18E-01 -5.14E-02 -4.59E-01
Thyroid cancer 2D10 Thyroid 3.96E-07 1.33E-01 5.18E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.57E-02 1.25E-01 4.53E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.84E-01 -7.25E-02 -5.69E-01
Type 2 diabetes 5A11 Liver tissue 8.58E-01 -1.06E-02 -2.93E-02
Ureter cancer 2C92 Urothelium 1.24E-01 -6.17E-02 -4.04E-01
Uterine cancer 2C78 Endometrium tissue 6.97E-01 6.32E-02 7.11E-02
Vitiligo ED63.0 Skin 4.69E-01 1.85E-01 5.65E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Rapid degradation of endothelin-1 by an enzyme released by the rat isolated perfused mesentery. Br J Pharmacol. 1995 Feb;114(4):867-71.