General Information of Drug-Metabolizing Enzyme (DME) (ID: DEXL3P2)

DME Name Deoxycytidylate deaminase (DCTD)
Synonyms Methyldeoxycytidine monophosphate deaminase; 5-methyldeoxycytidine monophosphate deaminase; dCMP-dCTP deaminase; dCMP deaminase; DCTD
Gene Name DCTD
UniProt ID
DCTD_HUMAN
INTEDE ID
DME0112
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1635
EC Number EC: 3.5.4.12
Hydrolases
Carbon-nitrogen hydrolase
Cyclic amidine hydrolase
EC: 3.5.4.12
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGC
SDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQA
GIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
Function This enzyme supplies the nucleotide substrate for thymidylate synthetase.
KEGG Pathway
Metabolic pathways (hsa01100 )
Pyrimidine metabolism (hsa00240 )
Reactome Pathway
Interconversion of nucleotide di- and triphosphates (R-HSA-499943 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Cytarabine DMZD5QR Acute lymphoblastic leukaemia 2A85 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.40E-58 8.76E-01 2.08E+00
Alopecia ED70 Skin from scalp 4.20E-02 1.73E-01 6.03E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.59E-01 2.53E-02 1.26E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.38E-01 3.99E-01 9.59E-01
Aortic stenosis BB70 Calcified aortic valve 9.90E-01 8.62E-02 8.43E-02
Apnea 7A40 Hyperplastic tonsil 5.74E-01 9.42E-02 1.45E-01
Arthropathy FA00-FA5Z Peripheral blood 4.60E-03 -2.70E-01 -1.61E+00
Asthma CA23 Nasal and bronchial airway 2.12E-01 1.03E-01 9.07E-02
Atopic dermatitis EA80 Skin 4.90E-04 -2.11E-01 -1.06E+00
Autism 6A02 Whole blood 3.65E-02 -1.64E-01 -5.73E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.43E-01 -2.26E-01 -9.58E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.47E-01 -1.43E-01 -2.76E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.86E-02 1.12E-01 4.83E-01
Batten disease 5C56.1 Whole blood 4.43E-01 -2.04E-01 -1.12E+00
Behcet's disease 4A62 Peripheral blood 4.70E-01 -7.57E-02 -5.00E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.07E-01 -8.44E-03 -4.09E-02
Bladder cancer 2C94 Bladder tissue 6.86E-06 -6.92E-01 -3.37E+00
Breast cancer 2C60-2C6Z Breast tissue 1.12E-02 -1.84E-03 -3.91E-03
Cardioembolic stroke 8B11.20 Whole blood 1.07E-01 -6.03E-02 -3.98E-01
Cervical cancer 2C77 Cervical tissue 1.19E-02 -3.48E-01 -6.94E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.17E-01 -1.28E-01 -1.00E-01
Chronic hepatitis C 1E51.1 Whole blood 2.02E-01 -1.14E-01 -3.99E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.16E-01 1.71E-02 9.28E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.93E-03 -1.29E-01 -5.23E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.47E-01 -9.24E-03 -4.19E-02
Colon cancer 2B90 Colon tissue 2.57E-60 7.00E-01 2.11E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.84E-01 3.43E-01 8.54E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.03E-01 2.56E-01 3.19E-01
Endometriosis GA10 Endometrium tissue 4.74E-01 -9.05E-02 -2.23E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.19E-01 -5.15E-02 -4.26E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.13E-10 6.11E-01 1.43E+00
Gastric cancer 2B72 Gastric tissue 9.67E-01 -3.54E-01 -4.77E-01
Glioblastopma 2A00.00 Nervous tissue 1.02E-02 9.29E-02 2.18E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.16E-01 1.29E-01 7.22E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.72E-03 6.52E-01 9.92E-01
Head and neck cancer 2D42 Head and neck tissue 8.52E-02 2.69E-02 1.23E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.13E-01 3.22E-02 1.07E-01
Huntington's disease 8A01.10 Whole blood 4.40E-01 -1.35E-01 -3.82E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.30E-01 6.70E-02 3.94E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.04E-02 -1.26E-01 -1.01E+00
Influenza 1E30 Whole blood 5.50E-03 -9.63E-01 -3.37E+00
Interstitial cystitis GC00.3 Bladder tissue 1.02E-03 -3.72E-01 -2.83E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.97E-08 6.54E-01 3.20E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.95E-01 -5.18E-01 -7.30E-01
Ischemic stroke 8B11 Peripheral blood 7.09E-01 -2.00E-02 -1.29E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.74E-06 -4.75E-01 -1.04E+00
Lateral sclerosis 8B60.4 Skin 5.89E-01 8.02E-02 9.65E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.39E-02 -3.10E-01 -6.37E-01
Liver cancer 2C12.0 Liver tissue 5.63E-06 -3.57E-01 -7.47E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.52E-03 -6.39E-01 -1.33E+00
Lung cancer 2C25 Lung tissue 1.49E-08 1.55E-01 6.52E-01
Lupus erythematosus 4A40 Whole blood 6.81E-02 -1.87E-01 -2.77E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.06E-01 -3.41E-02 -1.65E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.13E-01 4.61E-04 8.91E-04
Melanoma 2C30 Skin 1.13E-01 6.46E-01 6.94E-01
Multiple myeloma 2A83.1 Peripheral blood 5.07E-01 -4.48E-02 -2.10E-01
Multiple myeloma 2A83.1 Bone marrow 1.05E-06 1.21E+00 4.92E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.53E-01 -4.19E-03 -1.43E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.95E-01 1.21E-01 2.46E-01
Myelofibrosis 2A20.2 Whole blood 5.68E-03 -5.70E-01 -2.74E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.00E-02 -1.22E-01 -2.00E-01
Myopathy 8C70.6 Muscle tissue 6.99E-02 3.40E-01 9.29E-01
Neonatal sepsis KA60 Whole blood 2.40E-11 -5.30E-01 -1.34E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.17E-02 7.09E-01 1.14E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.24E-01 -2.64E-01 -6.82E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.79E-01 6.59E-03 9.89E-02
Olive pollen allergy CA08.00 Peripheral blood 8.82E-01 1.63E-01 4.46E-01
Oral cancer 2B6E Oral tissue 2.95E-06 5.17E-01 1.01E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.46E-01 7.56E-01 9.26E-01
Osteoporosis FB83.1 Bone marrow 8.72E-01 3.39E-02 5.00E-01
Ovarian cancer 2C73 Ovarian tissue 1.61E-01 -5.02E-02 -2.22E-01
Pancreatic cancer 2C10 Pancreas 1.22E-03 2.82E-01 1.20E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 7.50E-01 -8.42E-02 -2.06E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.38E-02 -1.29E-01 -7.39E-01
Pituitary cancer 2D12 Pituitary tissue 1.45E-04 3.81E-01 1.73E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.65E-02 2.62E-01 1.39E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.12E-01 2.44E-02 1.38E-01
Polycythemia vera 2A20.4 Whole blood 2.77E-16 -4.43E-01 -2.12E+00
Pompe disease 5C51.3 Biceps muscle 2.67E-04 8.51E-01 2.50E+00
Preterm birth KA21.4Z Myometrium 4.95E-01 -2.02E-01 -5.07E-01
Prostate cancer 2C82 Prostate 6.48E-06 -1.10E+00 -1.53E+00
Psoriasis EA90 Skin 8.20E-11 -1.50E-01 -3.77E-01
Rectal cancer 2B92 Rectal colon tissue 1.34E-02 2.45E-01 1.27E+00
Renal cancer 2C90-2C91 Kidney 1.28E-01 1.34E-01 3.85E-01
Retinoblastoma 2D02.2 Uvea 2.73E-11 1.58E+00 7.67E+00
Rheumatoid arthritis FA20 Synovial tissue 1.04E-04 1.10E+00 3.06E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.63E-01 2.60E-02 2.19E-01
Schizophrenia 6A20 Prefrontal cortex 6.07E-01 5.82E-02 1.44E-01
Schizophrenia 6A20 Superior temporal cortex 2.85E-01 3.45E-02 2.62E-01
Scleroderma 4A42.Z Whole blood 1.65E-05 -3.36E-01 -2.17E+00
Seizure 8A60-8A6Z Whole blood 6.67E-01 1.03E-01 3.43E-01
Sensitive skin EK0Z Skin 1.51E-01 1.36E-01 1.38E+00
Sepsis with septic shock 1G41 Whole blood 7.03E-70 -7.71E-01 -2.33E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.20E-03 -6.19E-01 -1.79E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.20E-01 1.45E-01 3.11E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.03E-01 9.02E-03 2.53E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.86E-01 -1.35E-01 -1.26E+00
Skin cancer 2C30-2C3Z Skin 2.03E-06 -2.07E-01 -3.12E-01
Thrombocythemia 3B63 Whole blood 4.25E-04 -3.20E-01 -1.52E+00
Thrombocytopenia 3B64 Whole blood 7.89E-01 1.49E-03 2.20E-03
Thyroid cancer 2D10 Thyroid 2.56E-27 -5.37E-01 -1.49E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.08E-04 2.69E-01 1.02E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.89E-01 7.56E-02 5.62E-01
Type 2 diabetes 5A11 Liver tissue 3.33E-01 6.51E-02 2.63E-01
Ureter cancer 2C92 Urothelium 7.70E-01 -4.48E-02 -1.73E-01
Uterine cancer 2C78 Endometrium tissue 7.25E-12 -3.38E-01 -8.36E-01
Vitiligo ED63.0 Skin 1.61E-01 9.11E-02 3.87E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Genetic factors influencing cytarabine therapy. Pharmacogenomics. 2009 Oct;10(10):1657-74.