Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEXPVUN)

DME Name Short-chain dehydrogenase/reductase retSDR1 (DHRS3)
Synonyms
Short chain dehydrogenase/reductase family 16C member 1; Retinal short-chain dehydrogenase/reductase 1; Retinol dehydrogenase 17; Short-chain dehydrogenase/reductase 3; DD83.1; DHRS3; RDH17; SDR16C1; UNQ2424/PRO4983; retSDR1
Gene Name DHRS3
UniProt ID
DHRS3_HUMAN
INTEDE ID
DME0414
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
9249
EC Number EC: 1.1.1.300
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.300
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAE
RGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITIL
VNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALS
AIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPP
LKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQAALEEIHKFSGTYTCMNTFKG
RT
Function This enzyme catalyzes the reduction of all-trans-retinal to all-trans- retinol in the presence of NADPH.
KEGG Pathway
Metabolic pathways (hsa01100 )
Retinol metabolism (hsa00830 )
Reactome Pathway
The retinoid cycle in cones (daylight vision) (R-HSA-2187335 )
RA biosynthesis pathway (R-HSA-5365859 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Acetohexamide DMR6N7H Diabetic complication 5A2Y Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.69E-08 -5.29E-01 -1.08E+00
Alopecia ED70 Skin from scalp 1.76E-01 7.76E-02 3.72E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.45E-06 2.53E-01 4.76E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.92E-01 -1.67E-01 -9.90E-01
Aortic stenosis BB70 Calcified aortic valve 7.71E-02 -1.30E-01 -3.97E-01
Apnea 7A40 Hyperplastic tonsil 9.19E-01 7.43E-02 2.47E-01
Arthropathy FA00-FA5Z Peripheral blood 4.48E-02 -3.35E-01 -1.09E+00
Asthma CA23 Nasal and bronchial airway 5.18E-06 2.57E-01 3.30E-01
Atopic dermatitis EA80 Skin 3.95E-01 -2.77E-02 -1.41E-01
Autism 6A02 Whole blood 9.04E-01 5.57E-02 1.62E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.89E-01 -5.50E-01 -1.09E+00
Autosomal dominant monocytopenia 4B04 Whole blood 6.21E-01 -1.16E-01 -3.74E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.94E-01 5.14E-02 1.41E-01
Batten disease 5C56.1 Whole blood 8.94E-01 8.29E-02 3.14E-01
Behcet's disease 4A62 Peripheral blood 1.08E-01 -1.22E-01 -3.79E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.23E-01 1.56E-01 4.94E-01
Bladder cancer 2C94 Bladder tissue 1.53E-03 -6.26E-01 -2.22E+00
Breast cancer 2C60-2C6Z Breast tissue 2.35E-67 -1.13E+00 -1.31E+00
Cardioembolic stroke 8B11.20 Whole blood 2.21E-10 -7.33E-01 -2.55E+00
Cervical cancer 2C77 Cervical tissue 8.40E-01 1.34E-01 2.13E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.18E-01 -5.20E-02 -5.19E-02
Chronic hepatitis C 1E51.1 Whole blood 1.56E-01 -2.65E-01 -1.11E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 8.83E-02 -2.03E-01 -5.63E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.06E-01 1.67E-01 4.50E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.36E-03 -3.94E-01 -1.19E+00
Colon cancer 2B90 Colon tissue 5.35E-19 -2.70E-01 -7.98E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.37E-02 6.02E-01 1.64E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.03E-01 1.35E-01 4.28E-01
Endometriosis GA10 Endometrium tissue 7.33E-05 7.86E-01 1.08E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.42E-03 3.70E-01 1.21E+00
Familial hypercholesterolemia 5C80.00 Whole blood 3.91E-01 -8.20E-02 -2.16E-01
Gastric cancer 2B72 Gastric tissue 8.70E-01 -1.81E-01 -2.77E-01
Glioblastopma 2A00.00 Nervous tissue 5.85E-07 3.23E-01 4.88E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.63E-01 5.75E-02 1.44E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.33E-01 -2.72E-01 -1.81E-01
Head and neck cancer 2D42 Head and neck tissue 3.98E-21 -8.30E-01 -1.02E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.18E-01 4.70E-02 1.44E-01
Huntington's disease 8A01.10 Whole blood 4.65E-01 2.46E-01 6.05E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.05E-01 2.15E-01 5.13E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.27E-04 -5.16E-01 -2.65E+00
Influenza 1E30 Whole blood 1.13E-01 1.31E-01 7.67E-01
Interstitial cystitis GC00.3 Bladder tissue 1.17E-04 -9.55E-01 -6.14E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.54E-02 9.85E-01 1.77E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.75E-01 -3.33E-01 -6.76E-01
Ischemic stroke 8B11 Peripheral blood 8.49E-01 -7.27E-02 -2.23E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.18E-09 -2.67E-01 -8.04E-01
Lateral sclerosis 8B60.4 Skin 2.86E-01 -1.31E-01 -1.64E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.18E-01 1.03E-03 9.21E-04
Liver cancer 2C12.0 Liver tissue 1.41E-06 -3.81E-01 -9.73E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.38E-04 -1.02E+00 -2.52E+00
Lung cancer 2C25 Lung tissue 9.13E-22 -4.12E-01 -1.16E+00
Lupus erythematosus 4A40 Whole blood 1.14E-09 -4.62E-01 -5.58E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.69E-02 -1.06E-01 -3.48E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.89E-01 -1.10E-01 -2.16E-01
Melanoma 2C30 Skin 1.53E-02 -7.49E-01 -8.32E-01
Multiple myeloma 2A83.1 Peripheral blood 9.05E-01 2.84E-02 1.49E-01
Multiple myeloma 2A83.1 Bone marrow 2.60E-02 -4.68E-01 -7.99E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.16E-01 1.93E-01 5.51E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.46E-01 2.75E-01 4.67E-01
Myelofibrosis 2A20.2 Whole blood 3.39E-02 -4.63E-01 -2.02E+00
Myocardial infarction BA41-BA50 Peripheral blood 8.68E-02 -3.99E-01 -4.87E-01
Myopathy 8C70.6 Muscle tissue 4.42E-01 -1.31E-02 -4.46E-02
Neonatal sepsis KA60 Whole blood 1.75E-39 -1.07E+00 -2.79E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.50E-05 -9.11E-01 -2.21E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.62E-01 -4.39E-02 -2.39E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.33E-03 3.58E-01 2.72E+00
Olive pollen allergy CA08.00 Peripheral blood 9.09E-01 -4.33E-01 -3.33E-01
Oral cancer 2B6E Oral tissue 2.86E-04 -4.92E-01 -1.05E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.56E-01 4.84E-01 5.45E-01
Osteoporosis FB83.1 Bone marrow 5.41E-01 -2.59E-01 -5.24E-01
Ovarian cancer 2C73 Ovarian tissue 8.76E-01 1.07E-01 1.72E-01
Pancreatic cancer 2C10 Pancreas 8.45E-02 2.84E-01 5.45E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.51E-01 1.82E-01 3.88E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.43E-03 -1.48E-01 -6.09E-01
Pituitary cancer 2D12 Pituitary tissue 2.54E-09 -1.51E+00 -4.05E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.70E-10 -1.80E+00 -4.89E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.17E-01 -7.10E-02 -3.52E-01
Polycythemia vera 2A20.4 Whole blood 4.21E-13 -3.36E-01 -1.34E+00
Pompe disease 5C51.3 Biceps muscle 8.79E-01 -8.08E-02 -4.56E-01
Preterm birth KA21.4Z Myometrium 2.58E-02 -7.52E-01 -1.96E+00
Prostate cancer 2C82 Prostate 6.83E-04 -1.25E-01 -3.38E-01
Psoriasis EA90 Skin 3.60E-13 -3.07E-01 -9.97E-01
Rectal cancer 2B92 Rectal colon tissue 3.82E-03 -4.41E-01 -1.50E+00
Renal cancer 2C90-2C91 Kidney 5.85E-01 1.47E-01 5.62E-01
Retinoblastoma 2D02.2 Uvea 1.57E-01 -4.62E-01 -1.01E+00
Rheumatoid arthritis FA20 Synovial tissue 1.27E-05 9.65E-01 3.64E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.84E-01 -7.56E-02 -3.64E-01
Schizophrenia 6A20 Prefrontal cortex 1.97E-02 2.56E-01 5.62E-01
Schizophrenia 6A20 Superior temporal cortex 5.88E-01 3.49E-02 9.69E-02
Scleroderma 4A42.Z Whole blood 3.54E-06 -5.64E-01 -2.94E+00
Seizure 8A60-8A6Z Whole blood 4.78E-01 -1.10E-02 -2.37E-02
Sensitive skin EK0Z Skin 7.77E-01 -6.76E-02 -2.83E-01
Sepsis with septic shock 1G41 Whole blood 4.11E-89 -1.01E+00 -2.98E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.20E-01 8.30E-02 2.87E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.20E-01 1.67E-01 2.23E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.94E-01 5.95E-01 1.24E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.62E-02 4.93E-02 4.24E-01
Skin cancer 2C30-2C3Z Skin 8.06E-66 -1.02E+00 -2.58E+00
Thrombocythemia 3B63 Whole blood 1.31E-04 -2.06E-01 -8.64E-01
Thrombocytopenia 3B64 Whole blood 6.52E-01 7.85E-01 5.90E-01
Thyroid cancer 2D10 Thyroid 9.05E-06 5.39E-01 1.60E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.82E-03 -3.24E-01 -8.13E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.98E-02 9.22E-01 1.89E+00
Type 2 diabetes 5A11 Liver tissue 7.49E-01 3.08E-02 1.65E-01
Ureter cancer 2C92 Urothelium 8.79E-01 -3.41E-02 -6.89E-02
Uterine cancer 2C78 Endometrium tissue 1.22E-03 5.18E-03 5.06E-03
Vitiligo ED63.0 Skin 2.29E-01 3.81E-02 1.78E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Molecular and biochemical characterisation of human short-chain dehydrogenase/reductase member 3 (DHRS3). Chem Biol Interact. 2015 Jun 5;234:178-87.