Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEY0TQC)

DME Name Dimethylarginine dimethylaminohydrolase 1 (DDAH1)
Synonyms Dimethylargininase-1; N(G),N(G)-dimethylarginine dimethylaminohydrolase 1; DDAH; DDAH-1; DDAH1; DDAHI
Gene Name DDAH1
UniProt ID
DDAH1_HUMAN
INTEDE ID
DME0548
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
23576
EC Number EC: 3.5.3.18
Hydrolases
Carbon-nitrogen hydrolase
Linear amidine hydrolase
EC: 3.5.3.18
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGL
QVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMK
DENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSM
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPE
EYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
Function This enzyme hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)- monomethyl-L-arginine (MMA).
Reactome Pathway
eNOS activation (R-HSA-203615 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
S-MTC DMO8G39 N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.46E-06 -9.33E-02 -5.35E-01
Alopecia ED70 Skin from scalp 6.36E-01 -4.84E-03 -2.67E-02
Alzheimer's disease 8A20 Entorhinal cortex 5.66E-03 -2.53E-01 -5.28E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.24E-01 6.11E-02 3.17E-01
Aortic stenosis BB70 Calcified aortic valve 9.91E-01 5.68E-02 2.26E-01
Apnea 7A40 Hyperplastic tonsil 8.05E-02 3.98E-02 2.89E-01
Arthropathy FA00-FA5Z Peripheral blood 1.07E-01 1.00E-01 8.20E-01
Asthma CA23 Nasal and bronchial airway 2.49E-05 -1.16E-01 -6.37E-02
Atopic dermatitis EA80 Skin 8.79E-01 -7.44E-03 -6.16E-02
Autism 6A02 Whole blood 6.46E-01 -4.94E-03 -2.82E-02
Autoimmune uveitis 9A96 Peripheral monocyte 6.62E-02 3.25E-01 2.06E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.94E-01 2.11E-02 1.41E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.87E-05 8.99E-02 5.42E-01
Batten disease 5C56.1 Whole blood 3.86E-01 6.82E-02 1.63E-01
Behcet's disease 4A62 Peripheral blood 3.15E-01 -1.43E-02 -6.18E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.14E-01 -1.07E-01 -4.81E-01
Bladder cancer 2C94 Bladder tissue 1.10E-02 -2.53E-01 -1.20E+00
Breast cancer 2C60-2C6Z Breast tissue 3.55E-04 -1.25E-01 -5.47E-01
Cardioembolic stroke 8B11.20 Whole blood 9.25E-01 1.15E-02 4.86E-02
Cervical cancer 2C77 Cervical tissue 6.72E-01 -9.87E-02 -5.35E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.38E-02 3.25E-02 2.73E-01
Chronic hepatitis C 1E51.1 Whole blood 8.98E-01 -1.25E-02 -1.20E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.62E-01 7.26E-02 2.33E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.35E-02 -1.87E-01 -5.32E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.34E-01 7.96E-02 8.52E-01
Colon cancer 2B90 Colon tissue 4.09E-16 -4.51E-01 -8.50E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.34E-01 -6.90E-02 -5.03E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.17E-01 -1.03E-01 -4.12E-01
Endometriosis GA10 Endometrium tissue 2.74E-01 -9.17E-02 -2.88E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.33E-01 -4.89E-03 -5.36E-02
Familial hypercholesterolemia 5C80.00 Whole blood 6.24E-03 -1.58E-01 -1.09E+00
Gastric cancer 2B72 Gastric tissue 9.44E-02 6.43E-02 8.34E-01
Glioblastopma 2A00.00 Nervous tissue 6.89E-29 -4.36E-01 -7.48E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.18E-01 1.59E-01 6.82E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.93E-02 3.09E-01 1.29E+00
Head and neck cancer 2D42 Head and neck tissue 2.16E-10 -2.33E-01 -6.78E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.34E-02 -1.72E-01 -4.52E-01
Huntington's disease 8A01.10 Whole blood 6.74E-01 -6.26E-02 -4.48E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.43E-02 -6.47E-01 -1.86E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.79E-01 1.40E-02 1.84E-01
Influenza 1E30 Whole blood 4.03E-01 -2.06E-01 -4.65E-01
Interstitial cystitis GC00.3 Bladder tissue 1.97E-02 -2.76E-01 -1.35E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.58E-01 -2.15E-02 -6.90E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.86E-01 -3.24E-02 -1.33E-01
Ischemic stroke 8B11 Peripheral blood 8.17E-01 5.80E-03 5.04E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 7.18E-06 2.01E-01 8.81E-01
Lateral sclerosis 8B60.4 Skin 7.67E-04 -5.94E-01 -3.42E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 8.23E-01 3.19E-02 1.08E-01
Liver cancer 2C12.0 Liver tissue 4.36E-05 -4.53E-01 -7.13E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.35E-03 -6.10E-01 -1.70E+00
Lung cancer 2C25 Lung tissue 4.32E-01 -9.38E-02 -2.18E-01
Lupus erythematosus 4A40 Whole blood 2.77E-01 4.33E-02 1.78E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.90E-02 -1.13E-01 -5.46E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.20E-01 4.73E-02 2.19E-01
Melanoma 2C30 Skin 4.41E-02 -2.13E-01 -1.89E-01
Multiple myeloma 2A83.1 Peripheral blood 1.08E-01 6.14E-02 6.44E-01
Multiple myeloma 2A83.1 Bone marrow 4.71E-01 -5.71E-02 -2.28E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.86E-01 1.03E-01 2.93E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.40E-07 1.77E-01 9.93E-01
Myelofibrosis 2A20.2 Whole blood 3.38E-03 1.61E-01 1.57E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.13E-02 2.53E-01 4.94E-01
Myopathy 8C70.6 Muscle tissue 1.34E-01 2.88E-01 6.81E-01
Neonatal sepsis KA60 Whole blood 7.29E-01 -6.69E-03 -4.78E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.67E-02 -3.84E-01 -9.99E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.65E-01 3.02E-01 1.01E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.48E-01 1.13E-01 4.99E-01
Olive pollen allergy CA08.00 Peripheral blood 1.33E-01 1.19E-01 5.71E-01
Oral cancer 2B6E Oral tissue 3.64E-04 -1.64E-01 -6.74E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.43E-01 6.24E-02 1.32E-01
Osteoporosis FB83.1 Bone marrow 3.60E-01 4.33E-01 5.90E-01
Ovarian cancer 2C73 Ovarian tissue 4.95E-01 6.21E-02 1.81E-01
Pancreatic cancer 2C10 Pancreas 3.95E-01 -7.80E-02 -1.22E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.88E-02 -9.86E-02 -2.53E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.10E-01 4.85E-02 3.62E-01
Pituitary cancer 2D12 Pituitary tissue 3.12E-01 3.34E-02 1.88E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.16E-01 1.26E-02 6.68E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.19E-01 -1.54E-02 -1.26E-01
Polycythemia vera 2A20.4 Whole blood 9.39E-13 1.78E-01 2.21E+00
Pompe disease 5C51.3 Biceps muscle 1.71E-01 -2.80E-01 -5.41E-01
Preterm birth KA21.4Z Myometrium 1.81E-01 -1.51E-01 -3.70E-01
Prostate cancer 2C82 Prostate 5.60E-09 7.72E-01 1.23E+00
Psoriasis EA90 Skin 8.78E-10 -2.64E-01 -7.83E-01
Rectal cancer 2B92 Rectal colon tissue 6.93E-01 6.06E-02 2.55E-01
Renal cancer 2C90-2C91 Kidney 1.65E-01 -1.53E-01 -3.35E-01
Retinoblastoma 2D02.2 Uvea 6.11E-07 -6.25E-01 -2.32E+00
Rheumatoid arthritis FA20 Synovial tissue 1.24E-01 -4.84E-02 -2.39E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.98E-01 -4.72E-03 -3.18E-02
Schizophrenia 6A20 Prefrontal cortex 9.25E-02 -3.36E-01 -3.67E-01
Schizophrenia 6A20 Superior temporal cortex 3.52E-01 -3.72E-02 -1.89E-01
Scleroderma 4A42.Z Whole blood 8.67E-01 1.78E-02 1.21E-01
Seizure 8A60-8A6Z Whole blood 5.35E-01 -2.35E-02 -1.43E-01
Sensitive skin EK0Z Skin 8.11E-01 9.59E-02 5.61E-01
Sepsis with septic shock 1G41 Whole blood 1.67E-08 8.92E-02 5.49E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.10E-01 2.35E-01 8.52E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.28E-02 9.21E-02 6.25E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.97E-01 1.43E-01 1.89E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.51E-01 3.62E-02 2.04E-01
Skin cancer 2C30-2C3Z Skin 1.13E-21 -4.02E-01 -1.08E+00
Thrombocythemia 3B63 Whole blood 7.42E-02 4.26E-02 4.20E-01
Thrombocytopenia 3B64 Whole blood 7.71E-02 1.83E-01 1.48E+00
Thyroid cancer 2D10 Thyroid 8.09E-02 4.05E-02 1.25E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.13E-01 2.30E-02 6.43E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.98E-02 -8.64E-01 -1.57E+00
Type 2 diabetes 5A11 Liver tissue 4.05E-01 -2.02E-02 -4.05E-02
Ureter cancer 2C92 Urothelium 3.74E-01 1.02E-01 3.58E-01
Uterine cancer 2C78 Endometrium tissue 1.11E-03 9.23E-02 3.84E-01
Vitiligo ED63.0 Skin 7.03E-01 -2.78E-02 -1.69E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Developing dual and specific inhibitors of dimethylarginine dimethylaminohydrolase-1 and nitric oxide synthase: toward a targeted polypharmacology to control nitric oxide. Biochemistry. 2009 Sep 15;48(36):8624-35.