Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEY1CBW)

DME Name Factor inhibiting HIF-1 (HIF1AN)
Synonyms Hypoxia-inducible factor 1-alpha inhibitor; Hypoxia-inducible factor asparagine hydroxylase; FIH-1; FIH1; HIF1AN
Gene Name HIF1AN
UniProt ID
HIF1N_HUMAN
INTEDE ID
DME0506
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
55662
EC Number EC: 1.14.11.3
Oxidoreductase
Oxygen paired donor oxidoreductase
2-oxoglutarate donor oxidoreductase
EC: 1.14.11.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEE
PVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNR
EEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWG
QLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQS
QVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGA
PTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Function This enzyme hydroxylates HIF-1 alpha at 'Asn-803' in the C-terminal transactivation domain (CAD).
Reactome Pathway
Cellular response to hypoxia (R-HSA-1234174 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
alpha-ketoglutaric acid DM5LFYN Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
alpha-ketoglutaric acid Discovery agent [N.A.] Investigative Km = 0.02 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.05E-06 -2.58E-01 -8.31E-01
Alopecia ED70 Skin from scalp 6.33E-01 1.06E-02 5.92E-02
Alzheimer's disease 8A20 Entorhinal cortex 7.24E-05 -1.06E-01 -6.39E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.35E-01 1.35E-01 5.78E-01
Aortic stenosis BB70 Calcified aortic valve 5.52E-01 -3.37E-01 -3.61E-01
Apnea 7A40 Hyperplastic tonsil 8.74E-01 -1.43E-01 -3.24E-01
Arthropathy FA00-FA5Z Peripheral blood 4.75E-01 -4.25E-02 -1.66E-01
Asthma CA23 Nasal and bronchial airway 8.18E-01 6.91E-02 1.38E-01
Atopic dermatitis EA80 Skin 4.94E-04 2.90E-01 1.23E+00
Autism 6A02 Whole blood 9.15E-01 -2.78E-02 -1.21E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.36E-01 5.59E-01 2.54E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.21E-01 -8.57E-01 -1.30E+00
Bacterial infection of gingival 1C1H Gingival tissue 7.35E-02 -7.49E-02 -3.28E-01
Batten disease 5C56.1 Whole blood 6.16E-01 -3.07E-02 -1.91E-01
Behcet's disease 4A62 Peripheral blood 8.72E-01 4.31E-02 2.41E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.48E-01 2.04E-02 1.22E-01
Bladder cancer 2C94 Bladder tissue 3.16E-01 -1.32E-01 -7.20E-01
Breast cancer 2C60-2C6Z Breast tissue 4.48E-13 2.19E-01 7.67E-01
Cardioembolic stroke 8B11.20 Whole blood 1.41E-04 2.34E-01 1.24E+00
Cervical cancer 2C77 Cervical tissue 5.49E-04 -3.71E-01 -9.55E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.81E-01 -1.33E-02 -8.97E-02
Chronic hepatitis C 1E51.1 Whole blood 3.32E-01 -2.35E-02 -1.33E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.91E-01 -5.73E-02 -2.58E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.57E-03 5.75E-02 2.87E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.32E-02 -1.55E-01 -1.28E+00
Colon cancer 2B90 Colon tissue 3.60E-07 -1.18E-01 -6.55E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.59E-01 2.84E-01 8.46E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.70E-01 -7.93E-02 -1.76E-01
Endometriosis GA10 Endometrium tissue 5.78E-01 1.06E-01 1.98E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.17E-01 5.33E-02 4.04E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.44E-01 8.21E-02 4.24E-01
Gastric cancer 2B72 Gastric tissue 1.77E-02 6.88E-01 4.31E+00
Glioblastopma 2A00.00 Nervous tissue 2.33E-91 -5.05E-01 -1.78E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.83E-01 -4.11E-01 -9.98E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.37E-02 -2.60E-01 -4.94E-01
Head and neck cancer 2D42 Head and neck tissue 7.93E-02 -6.04E-02 -2.86E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.08E-01 -5.79E-02 -1.71E-01
Huntington's disease 8A01.10 Whole blood 5.50E-02 -8.90E-02 -3.98E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.02E-01 3.30E-01 1.25E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.75E-03 1.79E-01 1.85E+00
Influenza 1E30 Whole blood 1.83E-03 -9.94E-01 -4.47E+00
Interstitial cystitis GC00.3 Bladder tissue 7.90E-01 -1.28E-02 -1.69E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.83E-03 -3.73E-01 -1.15E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.67E-01 -7.50E-03 -4.99E-02
Ischemic stroke 8B11 Peripheral blood 1.34E-03 -2.03E-01 -1.12E+00
Juvenile idiopathic arthritis FA24 Peripheral blood 4.84E-09 -2.22E-01 -9.99E-01
Lateral sclerosis 8B60.4 Skin 4.34E-01 3.88E-02 1.46E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.60E-01 9.10E-02 2.92E-01
Liver cancer 2C12.0 Liver tissue 7.53E-03 1.01E-01 2.46E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.36E-04 3.99E-01 1.68E+00
Lung cancer 2C25 Lung tissue 3.85E-05 5.07E-02 2.20E-01
Lupus erythematosus 4A40 Whole blood 2.23E-02 2.93E-01 3.20E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.72E-01 4.41E-02 2.98E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.37E-01 -2.11E-03 -1.17E-02
Melanoma 2C30 Skin 8.81E-03 -3.65E-01 -9.74E-01
Multiple myeloma 2A83.1 Peripheral blood 8.03E-01 -3.75E-02 -8.71E-02
Multiple myeloma 2A83.1 Bone marrow 4.47E-02 2.23E-01 1.04E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.53E-01 6.35E-02 2.82E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.22E-01 7.83E-02 1.96E-01
Myelofibrosis 2A20.2 Whole blood 4.72E-01 -5.90E-02 -3.15E-01
Myocardial infarction BA41-BA50 Peripheral blood 9.20E-03 -6.93E-01 -9.45E-01
Myopathy 8C70.6 Muscle tissue 2.79E-01 1.56E-02 3.31E-02
Neonatal sepsis KA60 Whole blood 1.45E-01 1.70E-02 4.68E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.69E-02 3.04E-01 1.01E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.34E-01 -6.92E-03 -4.27E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.10E-01 1.38E-01 8.10E-01
Olive pollen allergy CA08.00 Peripheral blood 1.42E-01 -2.48E-01 -7.62E-01
Oral cancer 2B6E Oral tissue 2.73E-01 -2.00E-02 -4.22E-02
Osteoarthritis FA00-FA0Z Synovial tissue 7.13E-01 7.16E-02 8.34E-02
Osteoporosis FB83.1 Bone marrow 1.12E-01 -1.39E-01 -1.41E+00
Ovarian cancer 2C73 Ovarian tissue 3.45E-01 -1.09E-02 -2.69E-02
Pancreatic cancer 2C10 Pancreas 3.58E-01 2.74E-02 8.90E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 9.52E-01 1.21E-01 4.49E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.55E-01 1.16E-01 6.26E-01
Pituitary cancer 2D12 Pituitary tissue 5.73E-08 9.82E-01 3.35E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.19E-07 9.08E-01 3.07E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.17E-01 2.31E-02 1.51E-01
Polycythemia vera 2A20.4 Whole blood 3.12E-01 1.38E-01 6.79E-01
Pompe disease 5C51.3 Biceps muscle 7.53E-05 -7.68E-01 -4.77E+00
Preterm birth KA21.4Z Myometrium 2.06E-01 2.87E-01 1.80E+00
Prostate cancer 2C82 Prostate 2.57E-04 1.03E+00 1.38E+00
Psoriasis EA90 Skin 5.51E-19 2.96E-01 7.71E-01
Rectal cancer 2B92 Rectal colon tissue 3.74E-01 -3.84E-02 -2.05E-01
Renal cancer 2C90-2C91 Kidney 4.30E-01 1.40E-01 5.24E-01
Retinoblastoma 2D02.2 Uvea 6.38E-06 7.29E-01 4.32E+00
Rheumatoid arthritis FA20 Synovial tissue 1.16E-01 1.74E-01 3.07E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.79E-01 1.20E-02 1.07E-01
Schizophrenia 6A20 Prefrontal cortex 3.48E-01 -5.93E-02 -2.52E-01
Schizophrenia 6A20 Superior temporal cortex 4.76E-01 2.74E-02 2.54E-01
Scleroderma 4A42.Z Whole blood 3.85E-01 5.16E-02 2.65E-01
Seizure 8A60-8A6Z Whole blood 1.84E-01 -8.60E-02 -5.95E-01
Sensitive skin EK0Z Skin 5.35E-01 -2.40E-02 -1.84E-01
Sepsis with septic shock 1G41 Whole blood 1.48E-06 1.37E-01 3.79E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.05E-01 4.61E-02 3.78E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.87E-01 2.31E-02 1.17E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.92E-01 -2.96E-02 -7.03E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.98E-04 3.91E-01 5.22E+00
Skin cancer 2C30-2C3Z Skin 2.90E-03 2.22E-01 4.54E-01
Thrombocythemia 3B63 Whole blood 9.31E-01 1.17E-01 6.07E-01
Thrombocytopenia 3B64 Whole blood 2.75E-01 -2.04E-01 -6.24E-01
Thyroid cancer 2D10 Thyroid 1.64E-02 3.12E-02 1.25E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.04E-07 -5.95E-01 -2.32E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.23E-01 -2.19E-01 -6.59E-01
Type 2 diabetes 5A11 Liver tissue 6.32E-01 3.34E-02 1.57E-01
Ureter cancer 2C92 Urothelium 3.17E-01 2.73E-03 2.07E-02
Uterine cancer 2C78 Endometrium tissue 5.80E-06 -1.20E-01 -3.05E-01
Vitiligo ED63.0 Skin 1.09E-03 2.26E-01 2.01E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The facial triad in the alpha-ketoglutarate dependent oxygenase FIH: a role for sterics in linking substrate binding to O2 activation. J Inorg Biochem. 2017 Jan;166:26-33.