General Information of Drug-Metabolizing Enzyme (DME) (ID: DEYMAD4)

DME Name Sulfotransferase 1C2 (SULT1C2)
Synonyms Sulfotransferase family cytosolic 1C member 2; Sulfotransferase 1C1; humSULTC2; ST1C2; SULT1C#1; SULT1C1; SULT1C2
Gene Name SULT1C2
UniProt ID
ST1C2_HUMAN
INTEDE ID
DME0614
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
6819
EC Number EC: 2.8.2.1
Transferase
Sulfotransferase
Sulfotransferase
EC: 2.8.2.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVD
MIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFW
ENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGW
WEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTN
RSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
Function This enzyme utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters.
Reactome Pathway
Cytosolic sulfonation of small molecules (R-HSA-156584 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Resveratrol DM3RWXL Giant cell arteritis 4A44.2 Phase 3 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.26E-01 2.01E-04 1.41E-03
Alzheimer's disease 8A20 Entorhinal cortex 5.91E-01 2.61E-02 1.19E-01
Asthma CA23 Nasal and bronchial airway 1.64E-05 1.32E-01 4.20E-01
Behcet's disease 4A62 Peripheral blood 2.71E-01 5.60E-02 5.27E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.17E-01 -2.28E-02 -1.75E-01
Bladder cancer 2C94 Bladder tissue 8.32E-01 -2.18E-01 -8.83E-01
Breast cancer 2C60-2C6Z Breast tissue 3.26E-06 1.58E-02 3.68E-02
Colon cancer 2B90 Colon tissue 1.95E-27 8.43E-01 1.15E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.15E-01 -5.46E-02 -2.62E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.13E-01 -6.53E-02 -7.03E-01
Gastric cancer 2B72 Gastric tissue 3.43E-01 -3.29E+00 -1.13E+00
Glioblastopma 2A00.00 Nervous tissue 1.02E-04 9.65E-02 2.67E-01
Head and neck cancer 2D42 Head and neck tissue 7.37E-01 -2.05E-02 -1.42E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.20E-01 -5.61E-02 -2.19E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.55E-02 4.46E-01 8.58E-01
Interstitial cystitis GC00.3 Bladder tissue 3.34E-01 -1.28E-01 -6.67E-01
Ischemic stroke 8B11 Peripheral blood 8.38E-02 9.12E-02 8.27E-01
Liver cancer 2C12.0 Liver tissue 6.61E-33 2.33E+00 3.85E+00
Liver failure DB99.7-DB99.8 Liver tissue 6.84E-02 4.34E-01 1.54E+00
Lung cancer 2C25 Lung tissue 1.11E-13 1.62E-01 3.33E-01
Lupus erythematosus 4A40 Whole blood 3.08E-01 -3.88E-02 -1.35E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.95E-01 -2.05E-02 -1.59E-01
Multiple myeloma 2A83.1 Bone marrow 1.05E-03 -5.01E-01 -2.35E+00
Multiple myeloma 2A83.1 Peripheral blood 1.95E-01 6.00E-02 5.91E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.71E-01 -5.29E-02 -3.90E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.97E-07 1.66E-01 7.01E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.23E-01 -2.75E-02 -6.26E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.74E-04 -4.16E-01 -1.99E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.79E-01 2.28E-01 9.14E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.14E-02 1.69E-01 1.51E+00
Olive pollen allergy CA08.00 Peripheral blood 4.79E-01 1.77E-02 1.07E-01
Oral cancer 2B6E Oral tissue 1.34E-02 -3.18E-01 -1.07E+00
Ovarian cancer 2C73 Ovarian tissue 7.80E-07 1.41E+00 3.58E+00
Pancreatic cancer 2C10 Pancreas 1.90E-02 1.17E+00 7.73E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.50E-01 -2.50E-03 -1.03E-02
Pituitary cancer 2D12 Pituitary tissue 1.32E-03 -5.02E-01 -1.31E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.55E-01 -1.39E-02 -6.71E-02
Pompe disease 5C51.3 Biceps muscle 8.35E-01 8.18E-02 7.47E-01
Prostate cancer 2C82 Prostate 3.44E-03 2.24E-01 6.30E-01
Psoriasis EA90 Skin 5.48E-02 -6.72E-02 -2.42E-01
Rectal cancer 2B92 Rectal colon tissue 2.80E-01 2.37E-01 5.01E-01
Renal cancer 2C90-2C91 Kidney 4.24E-06 -1.76E+00 -2.46E+00
Retinoblastoma 2D02.2 Uvea 7.17E-06 3.89E+00 2.56E+01
Schizophrenia 6A20 Prefrontal cortex 9.97E-01 -4.19E-02 -2.05E-01
Schizophrenia 6A20 Superior temporal cortex 3.77E-01 -3.15E-02 -2.54E-01
Scleroderma 4A42.Z Whole blood 1.93E-03 2.20E-01 1.56E+00
Seizure 8A60-8A6Z Whole blood 1.83E-01 -7.40E-02 -6.84E-01
Sepsis with septic shock 1G41 Whole blood 1.31E-02 2.40E-02 1.30E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.51E-01 7.91E-03 5.48E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 7.61E-01 4.21E-03 4.82E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.95E-04 1.66E-01 1.93E+01
Skin cancer 2C30-2C3Z Skin 3.13E-44 5.88E-01 1.87E+00
Thrombocythemia 3B63 Whole blood 2.36E-07 2.69E-01 2.54E+00
Thrombocytopenia 3B64 Whole blood 9.81E-01 2.84E-02 2.01E-01
Thyroid cancer 2D10 Thyroid 3.55E-30 -1.16E+00 -1.73E+00
Tibial muscular dystrophy 8C75 Muscle tissue 5.20E-01 2.72E-02 2.31E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.89E-02 3.31E-01 2.67E+00
Type 2 diabetes 5A11 Liver tissue 8.34E-01 6.06E-03 3.55E-02
Ureter cancer 2C92 Urothelium 9.80E-01 2.21E-04 1.49E-03
Uterine cancer 2C78 Endometrium tissue 1.67E-01 -1.41E-01 -2.76E-01
Vitiligo ED63.0 Skin 2.50E-01 -1.84E-01 -3.62E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 Correlation of reactive oxygen species levels with resveratrol sensitivities of anaplastic thyroid cancer cells. Oxid Med Cell Longev. 2018 Jul 10;2018:6235417.