Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEYZEJA)

DME Name Glutathione S-transferase mu-1 (GSTM1)
Synonyms Glutathione S-transferase Mu 1; GST HB subunit 4; GST class-mu 1; GST1; GSTM1; GSTM1-1; GSTM1a-1a; GSTM1b-1b; GTH4
Gene Name GSTM1
UniProt ID
GSTM1_HUMAN
INTEDE ID
DME0308
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2944
EC Number EC: 2.5.1.18
Transferase
Alkyl/aryl transferase
Alkyl/aryl transferase
EC: 2.5.1.18
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
Function This enzyme conjugates reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Fluid shear stress and atherosclerosis (hsa05418 )
Glutathione metabolism (hsa00480 )
Hepatocellular carcinoma (hsa05225 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pathways in cancer (hsa05200 )
Platinum drug resistance (hsa01524 )
Reactome Pathway
Glutathione conjugation (R-HSA-156590 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
5 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Azathioprine DMMZSXQ Lupus nephritis 4A40.0Y Approved [1]
Busulfan DMXYJ9C Chronic myelogenous leukaemia 2A20.0 Approved [2]
Carboplatin DMG281S Adenocarcinoma 2D40 Approved [3]
Cisplatin DMRHGI9 Adenocarcinoma 2D40 Approved [4]
Oxaliplatin DMQNWRD Adenocarcinoma 2D40 Approved [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.77E-12 1.06E+00 1.24E+00
Alopecia ED70 Skin from scalp 3.71E-03 2.47E-01 5.72E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.14E-01 8.29E-02 1.76E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.41E-01 3.36E-02 1.75E-01
Aortic stenosis BB70 Calcified aortic valve 8.60E-01 1.29E-01 2.13E-01
Apnea 7A40 Hyperplastic tonsil 6.53E-01 -2.22E-02 -3.69E-02
Arthropathy FA00-FA5Z Peripheral blood 2.68E-02 -2.34E-01 -3.22E-01
Asthma CA23 Nasal and bronchial airway 1.82E-05 -4.05E-01 -5.09E-01
Atopic dermatitis EA80 Skin 7.15E-01 2.17E-01 9.38E-01
Autism 6A02 Whole blood 2.32E-01 -3.77E-02 -8.79E-02
Autoimmune uveitis 9A96 Peripheral monocyte 4.72E-01 2.63E-01 7.95E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.96E-01 1.38E-01 2.97E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.21E-01 1.23E-01 1.89E-01
Batten disease 5C56.1 Whole blood 9.54E-01 -6.78E-01 -9.49E-01
Behcet's disease 4A62 Peripheral blood 1.28E-01 5.23E-01 8.32E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.04E-01 9.36E-02 2.68E-01
Bladder cancer 2C94 Bladder tissue 9.92E-01 5.21E-02 4.39E-02
Breast cancer 2C60-2C6Z Breast tissue 3.23E-33 -7.62E-01 -9.22E-01
Cardioembolic stroke 8B11.20 Whole blood 3.83E-01 4.48E-02 5.76E-02
Cervical cancer 2C77 Cervical tissue 3.91E-01 -3.49E-02 -5.68E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.86E-01 1.11E-01 1.79E-01
Chronic hepatitis C 1E51.1 Whole blood 2.33E-01 4.61E-01 1.03E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 2.91E-01 -2.22E-01 -3.90E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.29E-03 -1.23E-01 -2.58E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.30E-02 -5.93E-01 -1.71E+00
Colon cancer 2B90 Colon tissue 4.26E-55 -7.88E-01 -1.87E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.51E-02 1.73E-01 1.10E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.17E-01 2.74E-02 7.47E-02
Endometriosis GA10 Endometrium tissue 7.82E-01 -1.72E-01 -3.49E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.67E-01 -1.02E-01 -2.43E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.74E-01 -2.32E-01 -4.76E-01
Gastric cancer 2B72 Gastric tissue 6.34E-02 -1.03E+00 -2.55E+00
Glioblastopma 2A00.00 Nervous tissue 6.07E-09 -2.31E-01 -3.67E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.84E-07 5.22E-01 1.38E+02
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.54E-01 4.93E-02 4.54E-02
Head and neck cancer 2D42 Head and neck tissue 8.69E-08 -8.58E-01 -1.56E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.01E-01 -1.06E-01 -2.96E-01
Huntington's disease 8A01.10 Whole blood 7.73E-01 -1.67E-01 -3.64E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.47E-01 -2.40E-01 -4.05E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.30E-02 4.73E-01 1.85E+00
Influenza 1E30 Whole blood 7.90E-02 4.02E-01 1.67E+00
Interstitial cystitis GC00.3 Bladder tissue 4.83E-01 1.41E-01 9.35E-02
Intracranial aneurysm 8B01.0 Intracranial artery 1.18E-01 -1.34E-01 -1.64E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.28E-01 -3.01E-02 -6.44E-02
Ischemic stroke 8B11 Peripheral blood 1.99E-01 -1.50E-01 -2.35E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.85E-04 -3.58E-01 -4.28E-01
Lateral sclerosis 8B60.4 Skin 1.04E-01 -5.05E-01 -2.86E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 5.00E-01 -9.60E-02 -2.09E-01
Liver cancer 2C12.0 Liver tissue 1.08E-02 -2.99E-01 -1.79E-01
Liver failure DB99.7-DB99.8 Liver tissue 5.78E-02 1.36E+00 1.23E+00
Lung cancer 2C25 Lung tissue 2.90E-07 -3.52E-01 -6.58E-01
Lupus erythematosus 4A40 Whole blood 5.06E-01 -1.62E-02 -2.96E-02
Major depressive disorder 6A70-6A7Z Hippocampus 3.26E-02 -8.91E-02 -2.54E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.50E-01 -3.10E-01 -3.74E-01
Melanoma 2C30 Skin 5.48E-06 -6.80E-01 -1.21E+00
Multiple myeloma 2A83.1 Peripheral blood 1.69E-01 3.35E-01 1.26E+00
Multiple myeloma 2A83.1 Bone marrow 2.39E-01 1.15E-01 3.88E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.10E-01 1.77E-01 6.87E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.75E-01 -1.98E-01 -3.74E-01
Myelofibrosis 2A20.2 Whole blood 3.56E-01 -2.10E-01 -6.48E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.99E-02 -3.55E-01 -3.72E-01
Myopathy 8C70.6 Muscle tissue 7.92E-01 4.98E-02 1.34E-01
Neonatal sepsis KA60 Whole blood 2.44E-02 -2.58E-01 -5.62E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.30E-07 -1.79E+00 -4.39E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.50E-01 -5.59E-02 -3.92E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.83E-01 1.33E-01 3.50E-01
Olive pollen allergy CA08.00 Peripheral blood 3.27E-02 4.24E-01 1.86E+00
Oral cancer 2B6E Oral tissue 1.65E-02 -7.36E-01 -1.25E+00
Osteoarthritis FA00-FA0Z Synovial tissue 8.31E-01 3.35E-01 2.94E-01
Osteoporosis FB83.1 Bone marrow 1.46E-02 7.64E-01 4.39E+00
Ovarian cancer 2C73 Ovarian tissue 2.14E-04 -1.58E+00 -2.54E+00
Pancreatic cancer 2C10 Pancreas 2.31E-01 -8.55E-02 -1.60E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.39E-01 9.25E-02 2.58E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.86E-01 -5.19E-01 -9.77E-01
Pituitary cancer 2D12 Pituitary tissue 9.15E-03 1.12E+00 1.72E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.78E-04 1.49E+00 2.00E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.67E-01 7.81E-02 2.65E-01
Polycythemia vera 2A20.4 Whole blood 7.53E-01 2.34E-02 6.83E-02
Pompe disease 5C51.3 Biceps muscle 1.59E-01 -3.91E-02 -6.89E-02
Preterm birth KA21.4Z Myometrium 3.13E-01 -8.45E-02 -1.39E-01
Prostate cancer 2C82 Prostate 8.63E-05 -7.75E-01 -1.10E+00
Psoriasis EA90 Skin 2.33E-02 -1.80E-01 -3.01E-01
Rectal cancer 2B92 Rectal colon tissue 1.38E-02 -5.87E-01 -9.54E-01
Renal cancer 2C90-2C91 Kidney 5.30E-08 -8.91E-01 -3.45E+00
Retinoblastoma 2D02.2 Uvea 3.45E-01 -7.87E-02 -2.36E-01
Rheumatoid arthritis FA20 Synovial tissue 2.60E-02 6.94E-01 1.37E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.81E-01 -3.68E-02 -1.06E-01
Schizophrenia 6A20 Prefrontal cortex 9.30E-01 -4.06E-02 -8.10E-02
Schizophrenia 6A20 Superior temporal cortex 9.18E-01 -3.59E-02 -1.24E-01
Scleroderma 4A42.Z Whole blood 1.39E-01 3.86E-01 8.10E-01
Seizure 8A60-8A6Z Whole blood 5.18E-01 1.90E-02 3.98E-02
Sensitive skin EK0Z Skin 2.77E-01 -2.72E-01 -5.53E-01
Sepsis with septic shock 1G41 Whole blood 1.08E-08 -4.66E-01 -1.10E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.29E-01 -1.84E-01 -4.27E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.91E-02 5.00E-01 9.64E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.34E-01 9.75E-02 3.64E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.27E-01 1.95E-01 9.07E-01
Skin cancer 2C30-2C3Z Skin 2.27E-25 -6.46E-01 -1.08E+00
Thrombocythemia 3B63 Whole blood 7.72E-01 6.66E-02 1.98E-01
Thrombocytopenia 3B64 Whole blood 8.15E-01 1.67E-01 1.76E-01
Thyroid cancer 2D10 Thyroid 3.65E-13 -6.06E-01 -1.01E+00
Tibial muscular dystrophy 8C75 Muscle tissue 8.54E-02 -3.90E-01 -1.02E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.34E-02 7.96E-01 4.25E+00
Type 2 diabetes 5A11 Liver tissue 2.92E-01 2.98E+00 1.70E+00
Ureter cancer 2C92 Urothelium 7.24E-01 8.23E-02 2.35E-01
Uterine cancer 2C78 Endometrium tissue 2.61E-17 -8.59E-01 -1.17E+00
Vitiligo ED63.0 Skin 8.82E-01 2.21E-01 3.76E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 PharmGKB: A worldwide resource for pharmacogenomic information. Wiley Interdiscip Rev Syst Biol Med. 2018 Jul;10(4):e1417. (ID: PA2040)
2 Busulfan conjugation by glutathione S-transferases alpha, mu, and pi. Drug Metab Dispos. 1996 Sep;24(9):1015-9.
3 PharmGKB: A worldwide resource for pharmacogenomic information. Wiley Interdiscip Rev Syst Biol Med. 2018 Jul;10(4):e1417. (ID: PA150642262)
4 Glutathione S-transferase genetic polymorphisms and individual sensitivity to the ototoxic effect of cisplatin. Anticancer Drugs. 2000 Sep;11(8):639-43.