Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT03L8AN)

• DOT Name: Barrier-to-autointegration factor-like protein (BANF2)
• Synonyms: BAF-L; Barrier-to-autointegration factor 2
• Gene Name: BANF2
• Related Disease: Pulmonary tuberculosis
• UniProt ID: BAFL_HUMAN
• Pfam ID: PF02961
• Sequence:
  MDNMSPRLRAFLSEPIGEKDVCWVDGISHELAINLVTKGINKAYILLGQFLLMHKNEAEF
  QRWLICCFGATECEAQQTSHCLKEWCACFL
• Function: May play a role in BANF1 regulation and influence tissue-specific roles of BANF1.
• Tissue Specificity: Expressed strongly in testis and pancreas. Also detected in brain, colon, liver, lung, ovary, placenta, prostate, small intestine, spleen and thymus. Not detected in heart, kidney and skeletal muscle.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Pulmonary tuberculosis	DIS6FLUM	moderate	Biomarker	[1]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Barrier-to-autointegration factor-like protein (BANF2).	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Barrier-to-autointegration factor-like protein (BANF2).	[3]

References

• [1] Indicators for prediction of Mycobacterium tuberculosis positivity detected with bronchoalveolar lavage fluid.Infect Dis Poverty. 2018 Mar 24;7(1):22. doi: 10.1186/s40249-018-0403-x.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.