Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT19NLJR)

• DOT Name: Prickle-like protein 4 (PRICKLE4)
• Synonyms: Overexpressed breast tumor protein
• Gene Name: PRICKLE4
• Related Disease:
  Breast cancer
  Breast carcinoma
  Epithelial ovarian cancer
  Ovarian cancer
  Ovarian neoplasm
• UniProt ID: PRIC4_HUMAN
• Pfam ID: PF00412 ; PF06297
• Sequence:
  MSPQGPAVLSLGSLCLDTNQAPNWTGLQTLLQQLPPQDIDERYCLALGEEERAELQLFCA
  RRKQEALGQGVARLVLPKLEGHTCEKCRELLKPGEYGVFAARAGEQRCWHQPCFACQACG
  QALINLIYFYHDGQLYCGRHHAELLRPRCPACDQLIFSWRCTEAEGQRWHENHFCCQDCA
  GPLGGGRYALPGGSPCCPSCFENRYSDAGSSWAGALEGQAFLGETGLDRTEGRDQTSVNS
  ATLSRTLLAAAGGSSLQTQRGLPGSSPQQENRPGDKAEAPKGQEQCRLETIRDPKDTPFS
  TCSSSSDSEPEGFFLGERLPQSWKTPGSLQAEDSNASKTHCTMC
• Tissue Specificity: Expressed in a broad range of normal tissues as well as in hepatocellular carcinoma, breast cancer and prostate cancer tissues.
• KEGG Pathway: Wnt sig.ling pathway (hsa04310)

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Altered Expression	[1]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[1]
Epithelial ovarian cancer	DIS56MH2	Disputed	Altered Expression	[2]
Ovarian cancer	DISZJHAP	Disputed	Altered Expression	[2]
Ovarian neoplasm	DISEAFTY	Disputed	Altered Expression	[2]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Prickle-like protein 4 (PRICKLE4).	[3]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Prickle-like protein 4 (PRICKLE4).	[4]
AHPN	DM8G6O4	Investigative	AHPN decreases the expression of Prickle-like protein 4 (PRICKLE4).	[5]

References

• [1] Effects of common germline genetic variation in cell cycle control genes on breast cancer survival: results from a population-based cohort.Breast Cancer Res. 2008;10(3):R47. doi: 10.1186/bcr2100. Epub 2008 May 28.
• [2] FZD7 drives in vitro aggressiveness in Stem-A subtype of ovarian cancer via regulation of non-canonical Wnt/PCP pathway.Cell Death Dis. 2014 Jul 17;5(7):e1346. doi: 10.1038/cddis.2014.302.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [5] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.