Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1Y3M4K)

• DOT Name: Achaete-scute homolog 3 (ASCL3)
• Synonyms: ASH-3; hASH3; Class A basic helix-loop-helix protein 42; bHLHa42; bHLH transcriptional regulator Sgn-1
• Gene Name: ASCL3
• UniProt ID: ASCL3_HUMAN
• Pfam ID: PF00010
• Sequence:
  MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPS
  DSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHL
  PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRI
  V
• Function: Transcriptional repressor. Inhibits myogenesis. Plays a role in progenitor cells which differentiate into ductal and acinar, but not myoepithelial, cell lineages in the salivary glands. Involved in the functions of the microvillar cells and Bowman's glands and probably, in a non-cell-autonomous manner, in the development or regeneration of a complete olfactory epithelium (OE).
• Tissue Specificity: Widely expressed in fetal and adult tissues.

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Achaete-scute homolog 3 (ASCL3).	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Achaete-scute homolog 3 (ASCL3).	[2]

References

• [1] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.