Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1YFEP1)

• DOT Name: Tumor necrosis factor receptor superfamily member 17 (TNFRSF17)
• Synonyms: B-cell maturation protein; CD antigen CD269
• Gene Name: TNFRSF17
• UniProt ID: TNR17_HUMAN
• PDB ID: 1OQD; 1XU2; 2KN1; 4ZFO; 6J7W
• Pfam ID: PF09257
• Sequence:
  MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL
  GLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLE
  YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS
  ISAR
• Function: Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
• Tissue Specificity: Expressed in mature B-cells, but not in T-cells or monocytes.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Intesti.l immune network for IgA production (hsa04672)
• Reactome Pathway: TNFs bind their physiological receptors (R-HSA-5669034)

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Tumor necrosis factor receptor superfamily member 17 (TNFRSF17).	[1]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Tumor necrosis factor receptor superfamily member 17 (TNFRSF17).	[2]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Tumor necrosis factor receptor superfamily member 17 (TNFRSF17).	[3]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Tumor necrosis factor receptor superfamily member 17 (TNFRSF17).	[4]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial decreases the expression of Tumor necrosis factor receptor superfamily member 17 (TNFRSF17).	[5]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium decreases the expression of Tumor necrosis factor receptor superfamily member 17 (TNFRSF17).	[5]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Tumor necrosis factor receptor superfamily member 17 (TNFRSF17).	[6]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Tumor necrosis factor receptor superfamily member 17 (TNFRSF17).	[8]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Tumor necrosis factor receptor superfamily member 17 (TNFRSF17).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Tumor necrosis factor receptor superfamily member 17 (TNFRSF17).	[7]

References

• [1] Prenatal arsenic exposure and shifts in the newborn proteome: interindividual differences in tumor necrosis factor (TNF)-responsive signaling. Toxicol Sci. 2014 Jun;139(2):328-37. doi: 10.1093/toxsci/kfu053. Epub 2014 Mar 27.
• [2] Arsenic trioxide induces different gene expression profiles of genes related to growth and apoptosis in glioma cells dependent on the p53 status. Mol Biol Rep. 2008 Sep;35(3):421-9.
• [3] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [4] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [5] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [6] Induction of class II major histocompatibility complex expression in human multiple myeloma cells by retinoid. Haematologica. 2007 Jan;92(1):115-20.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Targeting MYC dependence in cancer by inhibiting BET bromodomains. Proc Natl Acad Sci U S A. 2011 Oct 4;108(40):16669-74. doi: 10.1073/pnas.1108190108. Epub 2011 Sep 26.