Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT37U1C8)

DOT Name Cystatin-9 (CST9)
Synonyms Cystatin-like molecule
Gene Name CST9
Related Disease
Craniosynostosis ( )
Disorder of sexual differentiation ( )
Bacterial infection ( )
UniProt ID
CST9_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00666
Sequence
MSSPQRRKAMPWALSLLLMGFQLLVTYAWCSEEEMGGNNKIVQDPMFLATVEFALNTFNV
QSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLE
LNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK
Function
May be involved in testis development. May play a role in hematopoietic differentiation or inflammation. Has immunomodulatory and antimicrobial functions against Francisella tularensis, a Gram-negative bacteria.
Tissue Specificity
Expressed in heart, placenta, lung, liver, skeletal muscle and pancreas . Not expressed in brain . Expressed in epididymis, kidney, testis, spinal cord, and thymus with a strong expression in epididymis and kidney and a weak expression in the spinal cord and thymus .

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Craniosynostosis DIS6J405 Strong Genetic Variation [1]
Disorder of sexual differentiation DISRMAEZ Strong Biomarker [2]
Bacterial infection DIS5QJ9S moderate Biomarker [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Cystatin-9 (CST9). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Cystatin-9 (CST9). [5]
------------------------------------------------------------------------------------

References

1 Lack of additional effects of long-term, low-dose clarithromycin combined treatment compared with topical steroids alone for chronic rhinosinusitis in China: a randomized, controlled trial.Int Forum Allergy Rhinol. 2018 Jan;8(1):8-14. doi: 10.1002/alr.22041. Epub 2017 Nov 30.
2 Isolation of the human testatin gene and analysis in patients with abnormal gonadal development.Mol Hum Reprod. 2002 Jan;8(1):8-15. doi: 10.1093/molehr/8.1.8.
3 Immunomodulatory and antibacterial effects of cystatin 9 against Francisella tularensis.Mol Med. 2013 Aug 28;19(1):263-75. doi: 10.2119/molmed.2013.00081.
4 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.