Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3VFQWS)

• DOT Name: Checkpoint protein HUS1B (HUS1B)
• Synonyms: hHUS1B
• Gene Name: HUS1B
• Related Disease:
  Keloid
  Neoplasm
• UniProt ID: HUS1B_HUMAN
• Pfam ID: PF04005
• Sequence:
  MKFRAKITGKGCLELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQ
  GAFQQFRMEGVSEDLDEIHLELTAEHLSRAARSAAGASSLKLQLTHKRRPSLTVAVELVS
  SLGRARSVVHDLPVRVLPRRVWRDCLPPSLRASDASIRLPRWRTLRSIVERMANVGSHVL
  VEANLSGRMTLSIETEVVSIQSYFKNLGNPPQSAVGVPENRDLESMVQVRVDNRKLLQFL
  EGQQIHPTTALCNIWDNTLLQLVLVQEDVSLQYFIPAL
• Tissue Specificity: Expressed strongly in testis, less in spleen, thymus, prostate, colon and leukocytes.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Keloid	DISV09JY	Strong	Genetic Variation	[1]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Checkpoint protein HUS1B (HUS1B).	[2]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Checkpoint protein HUS1B (HUS1B).	[3]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Checkpoint protein HUS1B (HUS1B).	[4]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde increases the expression of Checkpoint protein HUS1B (HUS1B).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Checkpoint protein HUS1B (HUS1B).	[5]

References

• [1] Differential susceptible loci expression in keloid and hypertrophic scars in the Chinese Han population.Ann Plast Surg. 2015 Jan;74(1):26-9. doi: 10.1097/SAP.0000000000000364.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [4] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.