Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4SQDSF)

DOT Name	Glutaredoxin domain-containing cysteine-rich protein 2 (GRXCR2)
Synonyms	GRXCR1-like protein; Glutaredoxin domain-containing cysteine-rich protein 1-like protein
Gene Name	GRXCR2
Related Disease	Autosomal recessive nonsyndromic hearing loss 101 ( ) Nonsyndromic genetic hearing loss ( ) Hearing loss, autosomal recessive ( )
UniProt ID	GRCR2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MEDPEKKLNQKSDGKPRKVRFKISSSYSGRVLKQVFEDGQELESPKEEYPHSFLQESLET MDGVYGSGEVPRPQMCSPKLTAQRISVFREGNAYTLAGGQPRFNDYKANDHKPLPIIDFG KIIIYTNNLKIIRTPMDKRDFVRKILQKEEEAEEESLMNKEESYGGRDQHDRPLVEAEST LPQNRYTQEGDIPEDSCFHCRGSGSATCSLCHGSKFSMLANRFKESYRALRCPACNENGL QPCQICNQ
Function	Could play a role in maintaining cochlear stereocilia bundles that are involved in sound detection.
Reactome Pathway	Sensory processing of sound by outer hair cells of the cochlea (R-HSA-9662361 ) Sensory processing of sound by inner hair cells of the cochlea (R-HSA-9662360 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Autosomal recessive nonsyndromic hearing loss 101	DISGUS75	Strong	Autosomal recessive	[1]
Nonsyndromic genetic hearing loss	DISZX61P	Moderate	Autosomal recessive	[2]
Hearing loss, autosomal recessive	DIS8G9R9	Supportive	Autosomal recessive	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Glutaredoxin domain-containing cysteine-rich protein 2 (GRXCR2).	[3]
------------------------------------------------------------------------------------

References

1	A frameshift mutation in GRXCR2 causes recessively inherited hearing loss. Hum Mutat. 2014 May;35(5):618-24. doi: 10.1002/humu.22545. Epub 2014 Apr 7.
2	Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.