Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5V1WAR)

DOT Name	Putative cancer susceptibility gene HEPN1 protein (HEPN1)
Gene Name	HEPN1
Related Disease	Hepatocellular carcinoma ( )
UniProt ID	HEPN1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MGNWGLGIAPWVDGESELEFRRLGMQGPLEALRRREWNTQRASFSFSFLIALSPHTVDYC HSYELFNRRWHGHVLATQRPSLFILMLV
Tissue Specificity	Expressed in liver. Expression is either down-regulated or lost in hepatocellular carcinomas (HCC).

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Hepatocellular carcinoma	DIS0J828	Definitive	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Putative cancer susceptibility gene HEPN1 protein (HEPN1).	[2]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Putative cancer susceptibility gene HEPN1 protein (HEPN1).	[2]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Putative cancer susceptibility gene HEPN1 protein (HEPN1).	[3]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Putative cancer susceptibility gene HEPN1 protein (HEPN1).	[4]
------------------------------------------------------------------------------------

References

1	MicroRNA-21 promotes cell proliferation in human hepatocellular carcinoma partly by targeting HEPN1.Tumour Biol. 2015 Jul;36(7):5467-72. doi: 10.1007/s13277-015-3213-9. Epub 2015 Feb 17.
2	Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
3	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.