Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7AJ1TT)

• DOT Name: GTPase IMAP family member 1 (GIMAP1)
• Synonyms: Immunity-associated protein 1; hIMAP1
• Gene Name: GIMAP1
• UniProt ID: GIMA1_HUMAN
• PDB ID: 3V70
• Pfam ID: PF04548
• Sequence:
  MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQRRFFSRLGAT
  SVTRACTTGSRRWDKCHVEVVDTPDIFSSQVSKTDPGCEERGHCYLLSAPGPHALLLVTQ
  LGRFTAQDQQAVRQVRDMFGEDVLKWMVIVFTRKEDLAGGSLHDYVSNTENRALRELVAE
  CGGRVCAFDNRATGREQEAQVEQLLGMVEGLVLEHKGAHYSNEVYELAQVLRWAGPEERL
  RRVAERVAARVQRRPWGAWLSARLWKWLKSPRSWRLGLALLLGGALLFWVLLHRRWSEAV
  AEVGPD
• Function: May regulate lymphocyte survival. Required for normal levels of mature T-lymphocytes and mature B-cells.
• Tissue Specificity: Predominantly expressed in the spleen and to a lesser extent in the lymph nodes. Detected in T-cells.

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of GTPase IMAP family member 1 (GIMAP1).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of GTPase IMAP family member 1 (GIMAP1).	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of GTPase IMAP family member 1 (GIMAP1).	[3]

References

• [1] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [2] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [3] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.