Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7GBIWW)

DOT Name	Cystatin-9-like (CST9L)
Synonyms	Testatin
Gene Name	CST9L
Related Disease	Disorder of sexual differentiation ( )
UniProt ID	CST9L_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00031
Sequence	MLGLPWKGGLSWALLLLLLGSQILLIYAWHFHEQRDCDEHNVMARYLPATVEFAVHTFNQ QSKDYYAYRLGHILNSWKEQVESKTVFSMELLLGRTRCGKFEDDIDNCHFQESTELNNTF TCFFTISTRPWMTQFSLLNKTCLEGFH
Tissue Specificity	Specifically expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Disorder of sexual differentiation	DISRMAEZ	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Cystatin-9-like (CST9L).	[2]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cystatin-9-like (CST9L).	[3]
------------------------------------------------------------------------------------

References

1	Isolation of the human testatin gene and analysis in patients with abnormal gonadal development.Mol Hum Reprod. 2002 Jan;8(1):8-15. doi: 10.1093/molehr/8.1.8.
2	Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.