General Information of Drug Off-Target (DOT) (ID: OTAYDFEU)

DOT Name Interferon alpha-14 (IFNA14)
Synonyms IFN-alpha-14; Interferon alpha-H; LeIF H; Interferon lambda-2-H
Gene Name IFNA14
UniProt ID
IFN14_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00143
Sequence
MALPFALMMALVVLSCKSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFE
FPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLE
ACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
Function Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
PI3K-Akt sig.ling pathway (hsa04151 )
Necroptosis (hsa04217 )
Toll-like receptor sig.ling pathway (hsa04620 )
NOD-like receptor sig.ling pathway (hsa04621 )
RIG-I-like receptor sig.ling pathway (hsa04622 )
Cytosolic D.-sensing pathway (hsa04623 )
JAK-STAT sig.ling pathway (hsa04630 )
.tural killer cell mediated cytotoxicity (hsa04650 )
Alcoholic liver disease (hsa04936 )
Tuberculosis (hsa05152 )
Hepatitis C (hsa05160 )
Hepatitis B (hsa05161 )
Measles (hsa05162 )
Human cytomegalovirus infection (hsa05163 )
Influenza A (hsa05164 )
Human papillomavirus infection (hsa05165 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Herpes simplex virus 1 infection (hsa05168 )
Epstein-Barr virus infection (hsa05169 )
Human immunodeficiency virus 1 infection (hsa05170 )
Coro.virus disease - COVID-19 (hsa05171 )
Pathways in cancer (hsa05200 )
Autoimmune thyroid disease (hsa05320 )
Lipid and atherosclerosis (hsa05417 )
Reactome Pathway
Regulation of IFNA/IFNB signaling (R-HSA-912694 )
TRAF6 mediated IRF7 activation (R-HSA-933541 )
SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671 )
Factors involved in megakaryocyte development and platelet production (R-HSA-983231 )
Interferon alpha/beta signaling (R-HSA-909733 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Beta-carotene DM0RXBT Approved Beta-carotene increases the expression of Interferon alpha-14 (IFNA14). [1]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Interferon alpha-14 (IFNA14). [2]
------------------------------------------------------------------------------------

References

1 Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
2 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.