Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB97F1J)

DOT Name	Heat shock protein beta-9 (HSPB9)
Synonyms	HspB9; Cancer/testis antigen 51; CT51
Gene Name	HSPB9
Related Disease	Neoplasm ( )
UniProt ID	HSPB9_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00011
Sequence	MQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDA HGFAPEELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLT PSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR
Tissue Specificity	Testis specific.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Neoplasm	DISZKGEW	Limited	Altered Expression	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Heat shock protein beta-9 (HSPB9).	[2]
Testosterone Undecanoate	DMZO10Y	Approved	Testosterone Undecanoate increases the expression of Heat shock protein beta-9 (HSPB9).	[3]
------------------------------------------------------------------------------------

References

1	Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1.Eur J Cell Biol. 2004 Aug;83(7):337-45. doi: 10.1078/0171-9335-00396.
2	Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
3	Levonorgestrel enhances spermatogenesis suppression by testosterone with greater alteration in testicular gene expression in men. Biol Reprod. 2009 Mar;80(3):484-92.