Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC234EW)

DOT Name	Small integral membrane protein 21 (SMIM21)
Gene Name	SMIM21
Related Disease	Congenital vertical talus ( )
UniProt ID	SMI21_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MDQYVSTAPPRFPIAQLGTFKQDSAGMGRIFKGNLLQKKALTTFENEHHIRFFTLLVLFH VMVLLRNHSRIQGVSEDWKRANSIFRNFLRLKSSRNTAEAE

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Congenital vertical talus	DISZF3HD	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Small integral membrane protein 21 (SMIM21).	[2]
------------------------------------------------------------------------------------

References

1	Narrowing the critical region for congenital vertical talus in patients with interstitial 18q deletions.Am J Med Genet A. 2013 May;161A(5):1117-21. doi: 10.1002/ajmg.a.35791. Epub 2013 Mar 13.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.