Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTCAX8NI)
| DOT Name | CD209 antigen (CD209) | ||||
|---|---|---|---|---|---|
| Synonyms | C-type lectin domain family 4 member L; Dendritic cell-specific ICAM-3-grabbing non-integrin 1; DC-SIGN; DC-SIGN1; CD antigen CD209 | ||||
| Gene Name | CD209 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| Pfam ID | |||||
| Sequence |
MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQV
SKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKL QEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAV GELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQ ELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQ NFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFS GNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA |
||||
| Function |
Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response; On DCs it is a high affinity receptor for ICAM2 and ICAM3 by binding to mannose-like carbohydrates. May act as a DC rolling receptor that mediates transendothelial migration of DC presursors from blood to tissues by binding endothelial ICAM2. Seems to regulate DC-induced T-cell proliferation by binding to ICAM3 on T-cells in the immunological synapse formed between DC and T-cells; (Microbial infection) Acts as an attachment receptor for HIV-1 and HIV-2; (Microbial infection) Acts as an attachment receptor for Ebolavirus; (Microbial infection) Acts as an attachment receptor for Cytomegalovirus; (Microbial infection) Acts as an attachment receptor for HCV; (Microbial infection) Acts as an attachment receptor for Dengue virus; (Microbial infection) Acts as an attachment receptor for Measles virus; (Microbial infection) Acts as an attachment receptor for Herpes simplex virus 1; (Microbial infection) Acts as an attachment receptor for Influenzavirus A; (Microbial infection) Acts as an attachment receptor for SARS-CoV; (Microbial infection) Acts as an attachment receptor for Japanese encephalitis virus; (Microbial infection) Acts as an attachment receptor for Lassa virus. Acts as an attachment receptor for Marburg virusn; (Microbial infection) Acts as an attachment receptor for Respiratory syncytial virus; (Microbial infection) Acts as an attachment receptor for Rift valley fever virus and uukuniemi virus; (Microbial infection) Acts as an attachment receptor for West-nile virus; (Microbial infection) Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of bacterial pathogen antigens, including Leishmania pifanoi LPG, Lewis-x antigen in Helicobacter pylori LPS, mannose in Klebsiella pneumonae LPS, di-mannose and tri-mannose in Mycobacterium tuberculosis ManLAM and Lewis-x antigen in Schistosoma mansoni SEA. Recognition of M.tuberculosis by dendritic cells occurs partially via this molecule.
|
||||
| Tissue Specificity |
Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||
References