Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTD8YYTL)

• DOT Name: Putative phospholipase B-like 2 (PLBD2)
• Synonyms: EC 3.1.1.-; 76 kDa protein; p76; LAMA-like protein 2; Lamina ancestor homolog 2; Phospholipase B domain-containing protein 2
• Gene Name: PLBD2
• Related Disease: Ulcerative colitis
• UniProt ID: PLBL2_HUMAN
• EC Number: 3.1.1.-
• Pfam ID: PF04916
• Sequence:
  MVGQMYCYPGSHLARALTRALALALVLALLVGPFLSGLAGAIPAPGGRWARDGQVPPASR
  SRSVLLDVSAGQLLMVDGRHPDAVAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGV
  VEAAVSEELIYMHWMNTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWH
  QVRLTLLQLKGLEDSYEGRVSFPAGKFTIKPLGFLLLQLSGDLEDLELALNKTKIKPSLG
  SGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFREGPWGDYPLVPGNKLVFS
  SYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNIVANRLASDGA
  TWADIFKRFNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQK
  TYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMR
  YNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSL
  ARILSLLAASGPTWDQVPPFQWSTSPFSGLLHMGQPDLWKFAPVKVSWD
• Function: Putative phospholipase.
• Tissue Specificity: Ubiquitously expressed, with highest levels in heart, brain and liver.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[1]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Putative phospholipase B-like 2 (PLBD2).	[2]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Putative phospholipase B-like 2 (PLBD2).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Putative phospholipase B-like 2 (PLBD2).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Putative phospholipase B-like 2 (PLBD2).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Putative phospholipase B-like 2 (PLBD2).	[6]

References

• [1] Cytomegalovirus in colorectal cancer and idiopathic ulcerative colitis.Rev Inst Med Trop Sao Paulo. 2008 Mar-Apr;50(2):83-7. doi: 10.1590/s0036-46652008000200004.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [4] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [5] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [6] Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.