Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTD98O80)

• DOT Name: Mitochondrial ornithine transporter 2 (SLC25A2)
• Synonyms: Solute carrier family 25 member 2
• Gene Name: SLC25A2
• UniProt ID: ORNT2_HUMAN
• Pfam ID: PF00153
• Sequence:
  MKSGPGIQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGL
  RGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDKQAKLSDLQTAAAGSFASAFA
  ALALCPTELVKCRLQTMYEMEMSGKIAKSHNTIWSVVKGILKKDGPLGFYHGLSSTLLQE
  VPGYFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWLVVFPVDCIKSRIQVL
  SMYGKQAGFIGTLLSVVRNEGIVALYSGLKATMIRAIPANGALFVAYEYSRKMMMKQLEA
  Y
• Function: Mitochondrial transporter of the positively charged amino acids ornithine, lysine and arginine, and the neutral amino acid citrulline. In addition, transports the basic amino acids histidine, homoarginine, and asymmetric dimethylarginine (aDMA), but not symmetric DMA, and the D-forms of lysine, arginine, ornithine and histidine. Functions by both counter-exchange and uniport mechanisms.
• Tissue Specificity: Expressed in liver, testis, spleen, lung, pancreas, and small intestine and expressed poorly in other tissues.
• Reactome Pathway: Urea cycle (R-HSA-70635)

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Mitochondrial ornithine transporter 2 (SLC25A2).	[1]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Mitochondrial ornithine transporter 2 (SLC25A2).	[3]
Mivebresib	DMCPF90	Phase 1	Mivebresib increases the expression of Mitochondrial ornithine transporter 2 (SLC25A2).	[3]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID decreases the expression of Mitochondrial ornithine transporter 2 (SLC25A2).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Mitochondrial ornithine transporter 2 (SLC25A2).	[2]

References

• [1] Epigallocatechin-3-gallate (EGCG) protects against chromate-induced toxicity in vitro. Toxicol Appl Pharmacol. 2012 Jan 15;258(2):166-75.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [3] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [4] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.