Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTE8FOEW)

• DOT Name: Nucleoside diphosphate-linked moiety X motif 17 (NUDT17)
• Synonyms: Nudix motif 17; EC 3.6.1.-
• Gene Name: NUDT17
• Related Disease:
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Clear cell renal carcinoma
  Gout
• UniProt ID: NUD17_HUMAN
• PDB ID: 5LF8
• EC Number: 3.6.1.-
• Pfam ID: PF00293
• Sequence:
  MAEVRVQLLLSRRPESVSFARSVCGLLGAGPGLGTWPIHCSLKRGRLVLSSRPFPGASAR
  LPLQRPPFCPFAALEERPRVPGAELPTDRGVDLGVAVILQSSDKTVLLTRRARTLSVSPN
  LWVPPGGHVELEEELLDGGLRELWEESGLHLPQGQFSWVPLGLWESAYPPRLSWGLPKYH
  HIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPDVAAAVAAAEDGTETPGLLPQDLP
  PSVLAVELEEDGRARPLVLHMSTLLRMIPTMAEDKERVSTGTKFALKLWLQHLGRTPPPC
  KSAAYLDPGPAKEEWNMDPLPPNQGSGK
• Function: Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[1]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[2]
Gout	DISHC0U7	Strong	Genetic Variation	[3]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Nucleoside diphosphate-linked moiety X motif 17 (NUDT17).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Nucleoside diphosphate-linked moiety X motif 17 (NUDT17).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Nucleoside diphosphate-linked moiety X motif 17 (NUDT17).	[6]

References

• [1] A transcriptome-wide association study of 229,000 women identifies new candidate susceptibility genes for breast cancer.Nat Genet. 2018 Jul;50(7):968-978. doi: 10.1038/s41588-018-0132-x. Epub 2018 Jun 18.
• [2] NUDT expression is predictive of prognosis in patients with clear cell renal cell carcinoma.Oncol Lett. 2017 Nov;14(5):6121-6128. doi: 10.3892/ol.2017.6997. Epub 2017 Sep 18.
• [3] Genome-wide association analyses identify 18 new loci associated with serum urate concentrations. Nat Genet. 2013 Feb;45(2):145-54. doi: 10.1038/ng.2500. Epub 2012 Dec 23.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.