Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEM6CR0)

DOT Name	Secretoglobin family 1D member 4 (SCGB1D4)
Synonyms	IFN-gamma-inducible secretoglobin; IIS
Gene Name	SCGB1D4
Related Disease	Advanced cancer ( ) Focal epilepsy ( )
UniProt ID	SG1D4_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF01099
Sequence	MRLSVCLLMVSLALCCYQAHALVCPAVASEITVFLFLSDAAVNLQVAKLNPPPEALAAKL EVKHCTDQISFKKRLSLKKSWWK
Function	Seems to be involved in the regulation of chemotactic cell migration and invasion.
Tissue Specificity	Expressed in all tissues; the highest level of expression is detectable in lymph nodes, tonsil, cultured lymphoblasts and ovary.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Focal epilepsy	DIS4LY5L	Strong	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Secretoglobin family 1D member 4 (SCGB1D4).	[3]
------------------------------------------------------------------------------------

References

1	Cancer, type 2 diabetes, and ageing: news from flies and worms.Swiss Med Wkly. 2004 Dec 18;134(49-50):711-9. doi: 10.4414/smw.2004.09885.
2	Interictal Slow and High-Frequency Oscillations: Is it an Epileptic Slow or Red Slow?.J Clin Neurophysiol. 2019 Mar;36(2):166-170. doi: 10.1097/WNP.0000000000000527.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.