Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTET1IKU)

DOT Name	Glucose-6-phosphatase 2 (G6PC2)
Synonyms	G-6-Pase 2; G6Pase 2; EC 3.1.3.9; Islet-specific glucose-6-phosphatase catalytic subunit-related protein
Gene Name	G6PC2
UniProt ID	G6PC2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	3.1.3.9
Pfam ID	PF01569
Sequence	MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWV AVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGAS CVWYVMVTAALSHTVCGMDKFSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI LGVIGGMLVAEAFEHTPGIQTASLGTYLKTNLFLFLFAVGFYLLLRVLNIDLLWSVPIAK KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNNYTLSFRLLCALTS LTILQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYSVHMLMKQSGKKSQ
Function	May hydrolyze glucose-6-phosphate to glucose in the endoplasmic reticulum. May be responsible for glucose production through glycogenolysis and gluconeogenesis.
Tissue Specificity	Specifically expressed in pancreas and also detected to a lower extent in testis. Expressed by most islet cells in the pancreas (at protein level).
KEGG Pathway	Glycolysis / Gluconeogenesis (hsa00010 ) Galactose metabolism (hsa00052 ) Starch and sucrose metabolism (hsa00500 ) Metabolic pathways (hsa01100 ) FoxO sig.ling pathway (hsa04068 ) PI3K-Akt sig.ling pathway (hsa04151 ) AMPK sig.ling pathway (hsa04152 ) Insulin sig.ling pathway (hsa04910 ) Adipocytokine sig.ling pathway (hsa04920 ) Glucagon sig.ling pathway (hsa04922 ) Insulin resistance (hsa04931 ) Carbohydrate digestion and absorption (hsa04973 )
Reactome Pathway	Gluconeogenesis (R-HSA-70263 )
BioCyc Pathway	MetaCyc:HS14422-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Biotransformations of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
D-glucose 6-phosphate	DMNRW57	Investigative	Glucose-6-phosphatase 2 (G6PC2) increases the hydrolysis of D-glucose 6-phosphate.	[3]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Glucose-6-phosphatase 2 (G6PC2).	[1]
(11-BETA)-11,21-DIHYDROXY-PREGN-4-ENE-3,20-DIONE	DMTPQ84	Investigative	(11-BETA)-11,21-DIHYDROXY-PREGN-4-ENE-3,20-DIONE increases the expression of Glucose-6-phosphatase 2 (G6PC2).	[1]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Glucose-6-phosphatase 2 (G6PC2).	[2]
------------------------------------------------------------------------------------

References

1	G6PC2 Modulates Fasting Blood Glucose In Male Mice in Response to Stress. Endocrinology. 2016 Aug;157(8):3002-8. doi: 10.1210/en.2016-1245. Epub 2016 Jun 14.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
3	Enzymatic characterization of the pancreatic islet-specific glucose-6-phosphatase-related protein (IGRP). J Biol Chem. 2004 Apr 2;279(14):13976-83. doi: 10.1074/jbc.M307756200. Epub 2004 Jan 13.