Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFQAUNQ)

• DOT Name: Putative cleavage and polyadenylation specificity factor subunit 4-like protein (CPSF4L)
• Gene Name: CPSF4L
• UniProt ID: CPS4L_HUMAN
• Pfam ID: PF14608 ; PF15663
• Sequence:
  MQEVIAGLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHD
  RGEKMVVCKHWLRGLCKKGDHCKFLHQYDLTRMPECYFYSKFGDCSNKECSFLHVKPAFK
  SQDCPWYDQGFCKDGPLCKYRHVPRIMCLNYLVGFCPEGPKCQFAQKIREFKLLPGSKI
• KEGG Pathway:
  mR. surveillance pathway (hsa03015)
  Influenza A (hsa05164)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Putative cleavage and polyadenylation specificity factor subunit 4-like protein (CPSF4L).	[1]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Putative cleavage and polyadenylation specificity factor subunit 4-like protein (CPSF4L).	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Putative cleavage and polyadenylation specificity factor subunit 4-like protein (CPSF4L).	[3]

References

• [1] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [2] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.