Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIHD7NB)

DOT Name	Uncharacterized protein C4orf51 (C4ORF51)
Gene Name	C4ORF51
UniProt ID	CD051_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15849
Sequence	MSHYFYLTPQILLPFSPLTSQEFDLIRRKAGASWQDETRWSDSSVTTYTGSYRKKQLDKS MCSQFSFRAGQHEPECKQMSLTNSSACHLLCWAGTQETTDIKGLFPDITRPFKKSFDVKH GVAHQIWDFGDCFPTPPNYGKYCVRPKKPAQEALINYSRRGKGVLKHLHGRCDSESKVCS SEDSEADRYSDYGWGGPSSPFN

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of Uncharacterized protein C4orf51 (C4ORF51).	[1]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Uncharacterized protein C4orf51 (C4ORF51).	[2]
------------------------------------------------------------------------------------

References

1	Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.