Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIMF82Y)

• DOT Name: Probable inactive ribonuclease-like protein 12 (RNASE12)
• Gene Name: RNASE12
• Related Disease: Epilepsy
• UniProt ID: RNS12_HUMAN
• Pfam ID: PF00074
• Sequence:
  MIIMVIIFLVLLFWENEVNDEAVMSTLEHLHVDYPQNDVPVPARYCNHMIIQRVIREPDH
  TCKKEHVFIHERPRKINGICISPKKVACQNLSAIFCFQSETKFKMTVCQLIEGTRYPACR
  YHYSPTEGFVLVTCDDLRPDSFLGYVK
• Function: Does not exhibit any ribonuclease activity.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Epilepsy	DISBB28L	Strong	Biomarker	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Probable inactive ribonuclease-like protein 12 (RNASE12).	[2]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Probable inactive ribonuclease-like protein 12 (RNASE12).	[3]

References

• [1] IL-1-31/IL1-RA genetic markers association with idiopathic generalized epilepsy and treatment response in a cohort of Egyptian population.Int J Neurosci. 2020 Apr;130(4):348-354. doi: 10.1080/00207454.2019.1688809. Epub 2019 Nov 7.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [3] BET bromodomain inhibition of MYC-amplified medulloblastoma. Clin Cancer Res. 2014 Feb 15;20(4):912-25.