Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIMIH5P)

• DOT Name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 (OST4)
• Gene Name: OST4
• UniProt ID: OST4_HUMAN
• PDB ID: 2LAT; 6S7O; 6S7T; 8B6L
• Pfam ID: PF10215
• Sequence: MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE
• Function: Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity. Specifically involved in maintaining stability of STT3A-containing OST complexes.

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 (OST4).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 (OST4).	[2]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 (OST4).	[3]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 (OST4).	[4]

References

• [1] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [4] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.