Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTJOJZHG)
DOT Name | Dual specificity phosphatase 29 (DUSP29) | ||||
---|---|---|---|---|---|
Synonyms | Dual specificity phosphatase 27; Dual specificity phosphatase DUPD1; EC 3.1.3.16, EC 3.1.3.48 | ||||
Gene Name | DUSP29 | ||||
UniProt ID | |||||
3D Structure | |||||
PDB ID | |||||
EC Number | |||||
Pfam ID | |||||
Sequence |
MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWP
KLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFD LSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKN RCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL |
||||
Function |
Dual specificity phosphatase able to dephosphorylate phosphotyrosine, phosphoserine and phosphothreonine residues within the same substrate, with a preference for phosphotyrosine as a substrate. Involved in the modulation of intracellular signaling cascades. In skeletal muscle regulates systemic glucose homeostasis by activating, AMPK, an energy sensor protein kinase. Affects MAP kinase signaling though modulation of the MAPK1/2 cascade in skeletal muscle promoting muscle cell differentiation, development and atrophy.
|
||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||||||
References